DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and babos

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:117 Identity:25/117 - (21%)
Similarity:44/117 - (37%) Gaps:18/117 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   544 SPSNSAPRTIVLHVLNGEYSASAIKSGSVSWSALIGCHGYLHWRNVSTLLTLLWII---KFALAR 605
            ||...:|..:....:|...|.:.|:...|.....:|.:  ||    |:.:.:||..   ..:..:
  Fly    51 SPQTKSPNPVASEKINKTLSVTGIRGEDVVLKCDVGSN--LH----SSDVVVLWYFGDNVISNGK 109

  Fly   606 DICQPNATSKATTRTSLLRAGDGATADVTRETGPKSGASFHRVSSSISATKV 657
            ::.|||....|....::|:|..........:..|         |.|:..|||
  Fly   110 NLVQPNFKLDANYDLTILKASPQVAGSYLCKVLP---------SGSVVNTKV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653
V-set 204..290 CDD:284989
babosNP_001286719.1 ig 70..154 CDD:278476 21/98 (21%)
IG_like 70..154 CDD:214653 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.