DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CG13506

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:347 Identity:74/347 - (21%)
Similarity:129/347 - (37%) Gaps:109/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SNNVAINNIS--NNGD-------QRLRLTAALEA----NLIMSNRNVQEQ-HSYRITQDNATSAA 136
            :|::.:.|:|  ::.|       ||:|...||..    :::..:|::.:: .::|....:.....
  Fly   127 NNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECR 191

  Fly   137 SIAP-NGT---AFGDAPSIPIGV------------------------------APATTTTIDPAT 167
            :..| |.|   :|.|....|..|                              .|..|..|| ..
  Fly   192 TYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHID-VQ 255

  Fly   168 TTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPI--SWLRMRDGH 230
            .:|..:|.|                    ..:.::.|..|.|.||.:   .|||  |:. ::||.
  Fly   256 YSPIVSTHR--------------------HNVNTEKGATAELYCNYR---AKPIGRSYF-IKDGK 296

  Fly   231 ILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQV-----STEPKASAIVHLRIV 290
            .|.:.....:.|    ||.:.: .|.:|.::.|...|.|.|.|||     |.|.|    ||:. .
  Fly   297 TLQLSDKYSLKD----SVHNDH-NRTTLIVREVTDSDLGEYLCQVENAIGSNEVK----VHVS-Y 351

  Fly   291 EPKTELIGESTRHVKAGSQVKLRCII------SQA-LEPPLFINWFYNQKQI---YLHNRRG--W 343
            .|:|....:.|   ..|::|.|..::      |:| |:..|..::.::..|:   :.||...  |
  Fly   352 NPETPQFEDMT---VEGNKVTLHWLVRSHQLLSEAMLDYQLTGSYTWSTVQVLETHRHNNTDNIW 413

  Fly   344 R----TEIERIDLPAEVPTTST 361
            :    .|:.|....|.|.|.:|
  Fly   414 KITHQLELSRGVWHARVKTKNT 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/98 (30%)
V-set 204..290 CDD:284989 29/92 (32%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 4/18 (22%)
IGc2 83..146 CDD:197706 4/18 (22%)
IG_like 176..254 CDD:214653 12/78 (15%)
Ig 176..239 CDD:299845 8/62 (13%)
I-set 258..349 CDD:254352 31/123 (25%)
Ig 275..348 CDD:143165 26/85 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.