DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and wrapper

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_477404.1 Gene:wrapper / 37555 FlyBaseID:FBgn0025878 Length:500 Species:Drosophila melanogaster


Alignment Length:495 Identity:101/495 - (20%)
Similarity:158/495 - (31%) Gaps:159/495 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPE 254
            |.|:..|:....|      |||.    :..|..::|.....:..|       |.|...:  |.|:
  Fly    41 PTTVKTYENDTVQ------LPCT----LNTPFRYVRWHRDDVALV-------DSRHPEL--PPPD 86

  Fly   255 R---W---SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVE----PKTELIGESTRHVKAGSQ 309
            |   |   |||:..||..|.|.|.|:::::  :..:|....:|    |:..:........:.|:.
  Fly    87 RIMLWPNGSLQVANVQSSDTGDYYCEMNSD--SGHVVQQHAIEVQLAPQVLIEPSDLTEQRIGAI 149

  Fly   310 VKLRCIISQALEPPLFINWFYN----QKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTA 370
            .::.| .:|.:..|: |.|..|    |.|....||:....||:                      
  Fly   150 FEVVC-EAQGVPQPV-ITWRLNGNVIQPQSNTGNRQSLILEIK---------------------- 190

  Fly   371 STTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATE 435
                                       |....||:        :.::.|.|.| .|.|.|.:   
  Fly   191 ---------------------------SRNQAGLI--------ECVASNGVGE-PAVANVYL--- 216

  Fly   436 TSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDA 500
                .:|...|.:.......|..|..|.......|..||.:.....|...|..|.:    ||.::
  Fly   217 ----HVLFSPEVSIPQPVVYTKLGSRAHLECIVEAAPAATVKWFHHGLPVALGAHS----TTHES 273

  Fly   501 EAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSAS 565
            |..|..:.        ..::..: ...|::.:|...|.|.|.|..||..                
  Fly   274 ELQTNRSV--------DHYVNAV-RHMLVVKSVRNADMGQYECRASNQI---------------- 313

  Fly   566 AIKSGSVSWSALIG----C-------------HGYLHWRNVSTLLTLLWIIKFALARDICQPNAT 613
            ::|||||.   |.|    |             | .|.|:..|.|..:.:.:||   |.|...|.|
  Fly   314 SVKSGSVE---LTGRPMPCLFKINPGTQSSTSH-VLVWQTESLLPIMEFKLKF---RQIPSNNVT 371

  Fly   614 SKATTRTSLL----RAGDGATADVTRETGPKSGASFHRVS 649
            .:..|..:.|    :|.:|.....|........||.:.||
  Fly   372 RQVRTNWTELTIPAQATNGLIYITTYTLHGLQPASLYEVS 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/97 (24%)
V-set 204..290 CDD:284989 22/91 (24%)
wrapperNP_477404.1 Ig 41..124 CDD:299845 26/103 (25%)
IG_like 41..118 CDD:214653 25/97 (26%)
IG_like 145..218 CDD:214653 22/139 (16%)
Ig 147..219 CDD:299845 22/138 (16%)
I-set 224..323 CDD:254352 26/130 (20%)
IGc2 236..314 CDD:197706 20/106 (19%)
FN3 339..431 CDD:238020 20/77 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.