DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Cadm4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001040572.1 Gene:Cadm4 / 365216 RGDID:1304722 Length:388 Species:Rattus norvegicus


Alignment Length:434 Identity:82/434 - (18%)
Similarity:150/434 - (34%) Gaps:134/434 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPTIDDYQT---IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVD----QTTF------IA 241
            |.|..:.||   .:::.|. |.:.|.:.|.           ||.|:.:.    ||.|      :.
  Rat    21 PGTAQEVQTENVTVAEGGV-AEITCRLHQY-----------DGSIVVIQNPARQTLFFNGTRALK 73

  Fly   242 DQRFQ-SVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRI-VEPKTELIGESTRHV 304
            |:||| ..||  |.|..:::...:|:|||.|.||:.||.....|..|.: |.|:..:: |.....
  Rat    74 DERFQLEEFS--PRRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVV-EVREQA 135

  Fly   305 KAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTT 369
            ..|.:|:|.|::.:: .|...:.|:.::|::                                  
  Rat   136 VEGGEVELSCLVPRS-RPAAVLRWYRDRKEL---------------------------------- 165

  Fly   370 ASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVAT 434
                                   :|.:|.:. ||.|....|.:...:.:.|      ..|:.:..
  Rat   166 -----------------------KGVSSGQE-NGKVWSVASTVRFRVDRKD------DGGIVICE 200

  Fly   435 ETSTA---------QLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAAT 490
            ..:.|         |.:.:|:.:.:..        :.::.|....|....:|.|.||:.......
  Rat   201 AQNQALPSGHSKQTQYVLDVQYSPTAR--------IHASQAVVREGDTLVLTCAVTGNPRPNQIR 257

  Fly   491 TSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVL 555
            .:....::...|.....|.|                   :|.:|..|:|.|||..:|.......|
  Rat   258 WNRGNESLPERAEALGETLT-------------------LPGLVSADNGTYTCEAANKHGHARAL 303

  Fly   556 HVLNGEYSASAIKSG--SVSWSALIGCHGYLHWRNVSTLLTLLW 597
            :|| ..|...|:...  ||.::.:.|....|.:..:..|:.::|
  Rat   304 YVL-VVYDPGAVVEAQTSVPYAIVGGILALLVFLIICVLVGMVW 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 31/105 (30%)
V-set 204..290 CDD:284989 29/97 (30%)
Cadm4NP_001040572.1 Ig 29..120 CDD:416386 30/104 (29%)
FR1 29..45 CDD:409353 3/16 (19%)
Ig strand A' 30..36 CDD:409353 0/5 (0%)
Ig strand B 38..46 CDD:409353 3/8 (38%)
CDR1 46..51 CDD:409353 1/15 (7%)
FR2 52..59 CDD:409353 1/6 (17%)
Ig strand C 52..58 CDD:409353 1/5 (20%)
CDR2 60..71 CDD:409353 3/10 (30%)
Ig strand C' 62..66 CDD:409353 2/3 (67%)
Ig strand C' 68..71 CDD:409353 0/2 (0%)
FR3 72..107 CDD:409353 15/36 (42%)
Ig strand D 76..83 CDD:409353 3/6 (50%)
Ig strand E 86..92 CDD:409353 1/5 (20%)
Ig strand F 99..107 CDD:409353 5/7 (71%)
CDR3 108..111 CDD:409353 2/2 (100%)
Ig strand G 111..120 CDD:409353 2/8 (25%)
FR4 113..120 CDD:409353 2/6 (33%)
IgI_2_Necl-4 121..220 CDD:409468 20/164 (12%)
Ig strand B 141..145 CDD:409468 2/3 (67%)
Ig strand C 155..159 CDD:409468 0/3 (0%)
Ig strand E 182..186 CDD:409468 1/3 (33%)
Ig strand F 196..201 CDD:409468 0/4 (0%)
Ig strand G 213..216 CDD:409468 0/2 (0%)
Ig strand A' 231..235 CDD:409353 1/3 (33%)
IGc2 237..298 CDD:197706 16/79 (20%)
Ig strand B 241..248 CDD:409353 2/6 (33%)
Ig strand C 255..260 CDD:409353 0/4 (0%)
Ig strand C' 262..264 CDD:409353 0/1 (0%)
Ig strand E 274..280 CDD:409353 2/24 (8%)
Ig strand F 287..294 CDD:409353 4/6 (67%)
Ig strand G 300..308 CDD:409353 3/8 (38%)
4.1m 344..362 CDD:128590 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12165
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5126
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.