DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Lac

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:193 Identity:60/193 - (31%)
Similarity:79/193 - (40%) Gaps:31/193 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 VATTTLKPPPTIDDY--QTIISQAGTHAYLPCNVKQLVKKPISWLRM-RDGHILTVDQTTFIADQ 243
            |..|..:..||| .|  |..|...|......|:|:...:..:.:|:. .|...|:...|..|.|.
  Fly    20 VQQTLAQRTPTI-SYITQEQIKDIGGTVEFDCSVQYAKEYNVLFLKTDSDPVFLSTGSTLVIKDS 83

  Fly   244 RFQSVFSPNPERWSLQIKYVQLKDEGTYECQV--STEPKASAIVHLRIVEPKTELIGESTRHVKA 306
            ||...:.||...:.||||.:|..|.|||.|||  ||..|.||.|.|.:..|.. :...||:.|.|
  Fly    84 RFSLRYDPNSSTYKLQIKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPV-ISDNSTQSVVA 147

  Fly   307 --GSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTT 367
              ||:|::.|..|....|.:                 .||.|...|     :||.|.|....|
  Fly   148 SEGSEVQMECYASGYPTPTI-----------------TWRRENNAI-----LPTDSATYVGNT 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 34/94 (36%)
V-set 204..290 CDD:284989 32/88 (36%)
LacNP_523713.2 IG_like 36..131 CDD:214653 34/94 (36%)
FR1 37..50 CDD:409353 2/12 (17%)
Ig strand A' 37..42 CDD:409353 1/4 (25%)
Ig strand B 44..51 CDD:409353 0/6 (0%)
CDR1 51..59 CDD:409353 1/7 (14%)
Ig strand C 59..63 CDD:409353 0/3 (0%)
FR2 60..63 CDD:409353 0/2 (0%)
CDR2 67..81 CDD:409353 3/13 (23%)
Ig strand C' 68..72 CDD:409353 1/3 (33%)
Ig strand C' 79..81 CDD:409353 0/1 (0%)
FR3 84..115 CDD:409353 14/30 (47%)
Ig strand D 84..90 CDD:409353 2/5 (40%)
Ig strand E 94..102 CDD:409353 3/7 (43%)
Ig strand F 108..115 CDD:409353 4/6 (67%)
CDR3 116..124 CDD:409353 3/7 (43%)
FR4 124..130 CDD:409353 3/5 (60%)
Ig strand G 124..130 CDD:409353 3/5 (60%)
Ig_3 134..208 CDD:404760 20/78 (26%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/20 (0%)
Ig strand E 187..191 CDD:409353 1/2 (50%)
Ig strand F 201..206 CDD:409353
Ig strand G 215..218 CDD:409353
Ig 227..318 CDD:416386
Ig strand C 256..260 CDD:409353
Ig strand E 286..290 CDD:409353
Ig strand F 300..305 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.