| Sequence 1: | NP_001287299.1 | Gene: | dpr15 / 41473 | FlyBaseID: | FBgn0037993 | Length: | 662 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_954545.1 | Gene: | Fgfrl1 / 360903 | RGDID: | 735156 | Length: | 529 | Species: | Rattus norvegicus |
| Alignment Length: | 306 | Identity: | 58/306 - (18%) |
|---|---|---|---|
| Similarity: | 99/306 - (32%) | Gaps: | 94/306 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 73 MAAALDAAAPNRSSNNVAINNISNNGDQRLRLTAALEAN---LIMSNRNVQEQHS---------- 124
Fly 125 --------------YRITQDNATSAASI-----------------APNGTAFGDAPSIPIGVAPA 158
Fly 159 TTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISW 223
Fly 224 LRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKA-SAIVHL 287
Fly 288 RIVE---PKTELIGES--TRHVKAGSQVKLRCIISQALEPPLFINW 328 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr15 | NP_001287299.1 | IG_like | 197..289 | CDD:214653 | 21/92 (23%) |
| V-set | 204..290 | CDD:284989 | 21/86 (24%) | ||
| Fgfrl1 | NP_954545.1 | I-set | 29..112 | CDD:400151 | 12/83 (14%) |
| Ig strand A' | 35..38 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 41..50 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 56..61 | CDD:409353 | 2/4 (50%) | ||
| Ig strand C' | 64..67 | CDD:409353 | 0/2 (0%) | ||
| Ig strand D | 72..77 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 78..84 | CDD:409353 | 0/5 (0%) | ||
| Ig strand F | 91..99 | CDD:409353 | 1/7 (14%) | ||
| Ig strand G | 102..112 | CDD:409353 | 1/9 (11%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 117..152 | 7/41 (17%) | |||
| IgI_2_FGFRL1-like | 143..234 | CDD:409442 | 29/124 (23%) | ||
| Ig strand B | 164..168 | CDD:409442 | 1/3 (33%) | ||
| Ig strand C | 177..181 | CDD:409442 | 2/5 (40%) | ||
| Ig strand E | 200..204 | CDD:409442 | 2/3 (67%) | ||
| Ig strand F | 214..219 | CDD:409442 | 2/4 (50%) | ||
| Ig strand G | 227..230 | CDD:409442 | 1/2 (50%) | ||
| Ig | 242..350 | CDD:416386 | 8/37 (22%) | ||
| Ig strand A | 242..245 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 249..253 | CDD:409353 | 0/3 (0%) | ||
| Ig strand B | 261..268 | CDD:409353 | 1/6 (17%) | ||
| Ig strand C | 272..279 | CDD:409353 | 3/7 (43%) | ||
| Ig strand D | 304..309 | CDD:409353 | |||
| Ig strand E | 317..322 | CDD:409353 | |||
| Ig strand F | 330..338 | CDD:409353 | |||
| Ig strand G | 341..349 | CDD:409353 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 405..427 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||