DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Cadm2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_038944379.1 Gene:Cadm2 / 360687 RGDID:1305678 Length:444 Species:Rattus norvegicus


Alignment Length:472 Identity:103/472 - (21%)
Similarity:150/472 - (31%) Gaps:112/472 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERW---SL 258
            |.:....|..|.|.|.|.|.....:.|..... ..|..|....:.|.|.:.|.:    .|   |:
  Rat    39 QNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQ-QTLYFDDKKALRDNRIELVRA----SWHELSI 98

  Fly   259 QIKYVQLKDEGTYECQVSTEPKASAIVHLRI--VEPKTELIGESTRHVKAGSQVKLRCIISQALE 321
            .:..|.|.|||.|.|.:.|.|..::..:|.:  |..|.::.|.|: .|..|..::|.|..|.: :
  Rat    99 SVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSS-PVMEGDLMQLTCKTSGS-K 161

  Fly   322 PPLFINWFYNQKQI----YLH----NRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTS 378
            |...|.||.|.|:|    ||.    ||:                                   |.
  Rat   162 PAADIRWFKNDKEIKDVKYLKEEDANRK-----------------------------------TF 191

  Fly   379 TTPATPSTTATGSTEGA-----TSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETST 438
            |..:|.......|.:|.     ...|:||....:..          .|.|:.....|.:...|..
  Rat   192 TVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAM----------QVLEIHYTPSVKIIPSTPF 246

  Fly   439 AQLLTEVEATSSTSG---------TSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAW 494
            .|....:..|..:.|         |..||. |........:|....|......|:.......:..
  Rat   247 PQEGQALTLTCESKGKPLPEPVLWTKDGAE-LPDPDRMVVSGRELNILFLNKTDNGTYRCEATNT 310

  Fly   495 LTTMDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLN 559
            :....||..........|:|| ::.|..:|||.:.....:       |.|||.||.         
  Rat   311 IGQSSAEYVLIVHDVPNTLLP-TTIIPSLTTAPVTTTVAI-------TTSPSTSAS--------- 358

  Fly   560 GEYSASAIKSGSVSWS-----ALIGCHGYLHWRNVSTLLTLLWIIKFALARDICQPNATSKATTR 619
               |:|.....|::..     ||||  |.:   .|...:||..|  |.|.|.:.:...|......
  Rat   359 ---SSSRRDPNSLAGQNGPDHALIG--GIV---AVVVFVTLCSI--FLLGRYLARHKGTYLTNEA 413

  Fly   620 TSLLRAGDGATADVTRE 636
            .....|.|..||.:..|
  Rat   414 KGAEDAPDADTAIINAE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/94 (27%)
V-set 204..290 CDD:284989 24/90 (27%)
Cadm2XP_038944379.1 IgV_1_Necl-3 35..130 CDD:409498 25/95 (26%)
Ig strand B 49..53 CDD:409498 2/3 (67%)
Ig strand C 62..66 CDD:409498 0/3 (0%)
Ig strand E 96..100 CDD:409498 1/3 (33%)
Ig strand F 110..115 CDD:409498 2/4 (50%)
Ig strand G 122..125 CDD:409498 0/2 (0%)
IgI_2_Necl-3 129..232 CDD:409467 29/149 (19%)
Ig strand B 151..155 CDD:409467 1/3 (33%)
Ig strand C 165..169 CDD:409467 1/3 (33%)
Ig strand E 195..199 CDD:409467 1/3 (33%)
Ig strand F 209..214 CDD:409467 0/4 (0%)
Ig strand G 225..228 CDD:409467 0/12 (0%)
IGc2 249..312 CDD:197706 9/63 (14%)
Ig strand B 251..260 CDD:409353 1/8 (13%)
Ig strand C 266..272 CDD:409353 0/5 (0%)
Ig strand C' 275..278 CDD:409353 1/3 (33%)
Ig strand D 281..286 CDD:409353 0/4 (0%)
Ig strand E 287..294 CDD:409353 2/6 (33%)
Ig strand F 301..309 CDD:409353 0/7 (0%)
Ig strand G 312..322 CDD:409353 2/9 (22%)
4.1m 397..415 CDD:128590 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12165
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5126
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.