DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Sdk2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:557 Identity:115/557 - (20%)
Similarity:175/557 - (31%) Gaps:187/557 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 QRTQSRREALIPATTQMAQTLDKASAFRPTMAAALDAAAPNRSSNNV-AINNISNNGDQRLR--L 104
            |.|..|....||.::::|.||:..       ...|...||:.....| |:|:  .|||.:..  :
  Rat   147 QVTWFRDGRKIPPSSRIAITLENT-------LVILSTVAPDAGRYYVQAVND--KNGDNKTSQPI 202

  Fly   105 TAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTT 169
            |.|:|        ||                           ..|:.||    |.|..|.|..|:
  Rat   203 TLAVE--------NV---------------------------GGPADPI----APTIIIPPKNTS 228

  Fly   170 PTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTV 234
            ....|...|...||                            |.:.|:|..|.|  .:||.:|  
  Rat   229 VVAGTSEVTMECVA----------------------------NARPLIKLHIVW--KKDGALL-- 261

  Fly   235 DQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIV----HLRIVEPKTE 295
              :..|:|...:...: ||          .:.|.|.|||:......:.|.|    :|.::|| .:
  Rat   262 --SNGISDYNRRLTIT-NP----------MVSDAGYYECEAMLRSSSVAPVTRGAYLSVLEP-PQ 312

  Fly   296 LIGESTRHVKAGSQ--VKLRCIISQALEPPLFINWF-------------YNQK------------ 333
            .:.|..||:.|..:  |.:.|.....  ||..|.|:             :.|:            
  Rat   313 FVREPERHITAEMEKVVDIPCRAKGV--PPPSITWYKDAALVEVGKLTRFKQRSDGGLQISGLLP 375

  Fly   334 ------QIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGST 392
                  |.:.||..|            |..|::....|:.....|.....||.....|......|
  Rat   376 DDTGMVQCFAHNAAG------------EAQTSTYLAVTSIAPNITRGPLDSTVIDGMSVVLACET 428

  Fly   393 EGA-------TSSETL--NGLVTITRSYILDA----ISQNDVSELGAAAGVAV---ATETSTAQL 441
            .||       ...|.:  :|.|.:.|..:|::    ||...:|:.|....:|.   ..:.::|.|
  Rat   429 SGAPRPAITWQKGERILASGSVQLPRFTLLESGSLLISPTHISDAGTYTCLATNSRGVDEASADL 493

  Fly   442 LTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTA 506
            :  |.|.:..:.......::..|.|:...|        .|.|...|  ....|    :.:.||.|
  Rat   494 V--VWARTRITKPPQDQSVIKGTQASMVCG--------VTHDPRVT--VRYVW----EKDGATLA 542

  Fly   507 ATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTC 543
            ..|...       |:.....||.|......|.|.|||
  Rat   543 VETNPR-------IRLDRNGSLHISQTWSGDIGTYTC 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 20/95 (21%)
V-set 204..290 CDD:284989 20/89 (22%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653
IGc2 43..101 CDD:197706
IG_like 123..206 CDD:214653 18/67 (27%)
Ig 135..191 CDD:299845 13/50 (26%)
IG_like 225..307 CDD:214653 25/126 (20%)
IGc2 236..289 CDD:197706 20/97 (21%)
I-set 311..400 CDD:254352 17/102 (17%)
Ig 329..397 CDD:143165 13/81 (16%)
I-set 405..495 CDD:254352 19/91 (21%)
Ig 419..495 CDD:299845 16/77 (21%)
Ig 505..589 CDD:299845 20/89 (22%)
IG_like 505..589 CDD:214653 20/89 (22%)
FN3 593..684 CDD:238020
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.