DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr19

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:427 Identity:99/427 - (23%)
Similarity:165/427 - (38%) Gaps:128/427 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYV 263
            :|:|.|..|.|||.||......:||:|.:|..:|||..:|..:|:||....:.:...|||:||.|
  Fly    50 VIAQKGGLAILPCVVKVNSPATVSWIRRKDFQLLTVGLSTHSSDKRFLVEHTRHMGHWSLRIKAV 114

  Fly   264 QLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW 328
            :.:|.|.||||:|..|..|.::.|:|||...|:......|:...|.::|.|.:.:|.|.|.|:.|
  Fly   115 REEDRGFYECQLSIYPTQSIVIELKIVEAVAEISSAPELHIDETSTLRLECKLKRATENPAFVFW 179

  Fly   329 FYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTE 393
            :::.|.|...::.|:                     ..|:...:...:.....::|:..:..:..
  Fly   180 YHDSKMINYDSQGGF---------------------VVTSIGQSNPQSGQFYRSSPANKSRATMP 223

  Fly   394 GATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGA 458
            ..:|:..||.|:..:     |||.       ..||.|..:|...|.|                  
  Fly   224 MESSNGVLNSLLGSS-----DAIK-------APAANVPSSTPYMTQQ------------------ 258

  Fly   459 GLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQI 523
                 ..:||....:..:.|                                         :||:
  Fly   259 -----HQSAYLLNPSVSVLT-----------------------------------------VKQV 277

  Fly   524 TTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSAS---AIKS------------GSVS 573
            ...          .:|||||:|||:.|.:|.:|||.||.:|:   |.:|            |.::
  Fly   278 NFR----------HAGNYTCAPSNARPASITVHVLRGEKTAAMQHANRSILDTETNGNGTFGLIT 332

  Fly   574 WSALIG------CHGYLHWRNVSTLLTLLWIIKFALA 604
            ...|.|      ..|.|::..:..|:..:...:|:||
  Fly   333 LGGLNGTSGVTLAGGILYFSGLFLLMGAVVFDRFSLA 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 36/89 (40%)
V-set 204..290 CDD:284989 34/85 (40%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 32/76 (42%)
IGc2 55..125 CDD:197706 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I11088
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.