DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:266 Identity:62/266 - (23%)
Similarity:97/266 - (36%) Gaps:53/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDE 268
            |..|.|.|.|..||...::|||:....||::.......:.|. |:.......|.|:|:.||..|.
  Fly    45 GRDALLTCVVHDLVSFKVAWLRVDTQTILSIQNHVITKNHRI-SISHTEHRIWQLKIRDVQESDR 108

  Fly   269 GTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHV--KAGSQVKLRCIISQALEPPLFINWFYN 331
            |.|.||::|:|..|.:.:|.:|.|...:..::::.|  ..|..|.|.|  |....|...|.|...
  Fly   109 GWYMCQINTDPMKSQMGYLDVVVPPDIVDYQTSQDVVRSTGQNVTLTC--SATGVPMPTITWRRE 171

  Fly   332 QKQIYLHNRRGWRT------------EIERIDLPAEV--------PTTSTTTTTTTTTASTTTTT 376
            :....|.:..|.|.            :::|..:.|.:        ||.|.........|.|..|.
  Fly   172 EATPILISDDGDREVFSVEGQNLTLWQVQRSHMGAYLCIASNGVPPTVSKRVMLVVNFAPTIWTR 236

  Fly   377 TST--------------TPATPSTT----------ATGSTEGATSSETLNGLVTITRSYILDAIS 417
            ..|              |.:.|::.          ..||.|..:.......::.||    |..|:
  Fly   237 YDTIYVGLGQKLTLECITESQPASVNFWLRDSQLLQGGSYESVSVDHVFRIVMRIT----LRPIT 297

  Fly   418 QNDVSE 423
            :.|..|
  Fly   298 KRDFGE 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/84 (33%)
V-set 204..290 CDD:284989 28/85 (33%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/80 (34%)
Ig 39..122 CDD:299845 26/77 (34%)
Ig 132..213 CDD:299845 15/82 (18%)
IG_like 141..227 CDD:214653 17/87 (20%)
IG_like 239..322 CDD:214653 12/69 (17%)
IGc2 245..313 CDD:197706 11/63 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.