DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment dpr15 and Obscn

DIOPT Version :9

Sequence 1:	NP_001287299.1	Gene:	dpr15 / 41473	FlyBaseID:	FBgn0037993	Length:	662	Species:	Drosophila melanogaster
Sequence 2:	XP_038943147.1	Gene:	Obscn / 338458	RGDID:	631335	Length:	9211	Species:	Rattus norvegicus

Alignment Length:	645	Identity:	131/645 - (20%)
Similarity:	207/645 - (32%)	Gaps:	215/645 - (33%)

- Green bases have known domain annotations that are detailed below.

  Fly    15 LLICLPAIRGQAEETSILNSNGTNGRAFQRTQSRR--EALIPATTQMAQTLDKASAFRPTMAAAL 77
            |.||..|:....|.:.:...        :||.:..  :||.|..|:..:..:.......|:...:
  Rat  4548 LQICGLAVEDSGEYSCVCGQ--------ERTSATLTVDALPPKFTEGLKKEEATEGNMATLRCQM 4604

  Fly    78 DAAAPNRSSNNVAINNISNNGDQRLRLTAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNG 142
            ..|||..          ...|.:.||                 :...|.:.||.|  |..:...|
  Rat  4605 SKAAPVE----------WRKGSETLR-----------------DGGRYSLRQDGA--ACELQIRG 4640

  Fly   143 TAFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLK--PPPTIDDYQTIISQAGT 205
            .|..||...........|:                     ||.::|  ||..|:|.::..:..|.
  Rat  4641 LALEDAGEYSCLCGQEKTS---------------------ATLSVKALPPRFIEDLRSQEATEGN 4684

  Fly   206 HAYLPCNVKQLVKKPISWLR----MRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLK 266
            ...|.|.:.::.  |:.|.:    :|||...::.|...:.:               |||..:.|:
  Rat  4685 MVTLRCQMSKVT--PVEWRKGSETLRDGGRYSLRQDGAVCE---------------LQIHRLALE 4732

  Fly   267 DEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKA--GSQVKLRCIISQALEPPLFINW- 328
            |.|.|.|....| |.||.:.::.:.|:   ..|..|..||  |:.|.|||.:|:|..    :.|
  Rat  4733 DAGEYSCLCGQE-KTSATLSVKALPPR---FTEDLRSQKATEGTMVTLRCQMSKAAP----VEWR 4789

  Fly   329 ----------FYNQKQ---IYLHNRRGWRTE-----------------IERIDLPA--------- 354
                      .|:.:|   :|....||...|                 :....|||
  Rat  4790 KGSETLRDGGRYSLRQDGAVYELQIRGLALEDAGEYSCVCGQEKTSATLSVKALPARFIEDLRSQ 4854

  Fly   355 EVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGS---TEGATSSETLNGLVTITRSYILDAI 416
            |||           .:||.|.....:...|.....||   ..||..|...:|  .:....|.| :
  Rat  4855 EVP-----------ESSTVTMRCELSKKAPVVWRKGSETLKNGARYSLRQDG--AVCELEIRD-L 4905

  Fly   417 SQNDVSELGAAAG-------VAV---------------ATETSTAQLLTEVEATSSTSGTSTG-- 457
            :..|..|.....|       :::               |.|.|||.|..|:...::....|.|
  Rat  4906 TVEDAGEYSCTCGKERTSATLSIMAPQVVFQKLLENLQAEEGSTASLRCELSVPNTAVVWSKGGL 4970

  Fly   458 ----------------AGLLASTSAAYAAGAAAGITTAATGDSAATAATTSA------WLTTMDA 500
                            |.||........||..:  .|..:..::||...|:|      .|...|.
  Rat  4971 ELQADTCRETRQQGCVAELLLRDVRREDAGEYS--CTCGSQTTSATLMVTAAPVRFLQELQAQDV 5033

  Fly   501 EAATTAATT---------------TTTMLPSSSF--IKQITTASLIIPAVVKLDSGNYTC 543
            :..|||...               :..:.|.:.:  :::.|||.|::..|.:.|:|.|||
  Rat  5034 DEGTTARLRCELSREAASVEWRKGSLQLFPCAKYQMVQEGTTAELLVHGVEQEDAGEYTC 5093

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
dpr15	NP_001287299.1	IG_like	197..289	CDD:214653	21/95 (22%)
dpr15	NP_001287299.1	V-set	204..290	CDD:284989	21/89 (24%)
Obscn	XP_038943147.1	Ig strand C'	2122..2125	CDD:409353
		Ig strand D	2130..2135	CDD:409353
		Ig strand E	2138..2143	CDD:409353
		Ig strand F	2152..2158	CDD:409353
		Ig strand G	2161..2169	CDD:409353
		Ig	2187..2253	CDD:416386
		Ig strand B	2196..2200	CDD:409353
		Ig strand C	2209..2213	CDD:409353
		Ig strand E	2234..2238	CDD:409353
		Ig strand F	2248..2253	CDD:409353
		Ig	2273..2353	CDD:416386
		Ig strand A	2273..2275	CDD:409353
		Ig strand A'	2278..2281	CDD:409353
		Ig strand B	2285..2291	CDD:409353
		Ig strand C	2298..2303	CDD:409353
		Ig strand C'	2306..2309	CDD:409353
		Ig strand D	2314..2319	CDD:409353
		Ig strand E	2322..2327	CDD:409353
		Ig strand F	2336..2342	CDD:409353
		Ig strand G	2345..2353	CDD:409353
		Ig	2360..2443	CDD:416386
		Ig strand A'	2367..2371	CDD:409353
		Ig strand B	2375..2381	CDD:409353
		Ig strand C	2388..2393	CDD:409353
		Ig strand C'	2396..2399	CDD:409353
		I-set	9..98	CDD:400151
		Ig strand A	9..13	CDD:409353
		Ig strand A'	16..21	CDD:409353
		Ig strand B	25..33	CDD:409353
		Ig strand C	39..44	CDD:409353
		Ig strand C'	47..49	CDD:409353
		Ig strand D	55..58	CDD:409353
		Ig strand E	61..67	CDD:409353
		Ig strand F	77..85	CDD:409353
		I-set	109..200	CDD:400151
		Ig strand A'	115..120	CDD:409353
		Ig strand B	126..133	CDD:409353
		Ig strand C	139..144	CDD:409353
		Ig strand C'	146..148	CDD:409353
		Ig strand D	156..159	CDD:409353
		Ig strand E	166..172	CDD:409353
		Ig strand F	179..186	CDD:409353
		I-set	246..326	CDD:400151
		Ig strand B	252..259	CDD:409353
		Ig strand C	266..272	CDD:409353
		Ig strand C'	273..276	CDD:409353
		Ig strand D	282..288	CDD:409353
		Ig strand E	291..301	CDD:409353
		Ig strand F	305..313	CDD:409353
		Ig strand G	315..326	CDD:409353
		Ig	333..416	CDD:416386
		Ig strand A'	335..341	CDD:409353
		Ig strand B	348..355	CDD:409353
		Ig strand C	360..365	CDD:409353
		Ig strand D	375..379	CDD:409353
		Ig strand E	384..391	CDD:409353
		Ig strand F	398..405	CDD:409353
		Ig strand A	422..424	CDD:409353
		Ig	423..492	CDD:416386
		Ig strand A'	427..431	CDD:409353
		Ig strand B	435..441	CDD:409353
		Ig strand C	448..453	CDD:409353
		Ig strand C'	456..459	CDD:409353
		Ig strand D	464..469	CDD:409353
Ig strand E	472..477	CDD:409353
Ig strand F	486..492	CDD:409353
Ig strand G	495..503	CDD:409353
FN3	513..600	CDD:238020
Ig	615..>671	CDD:416386
Ig	710..789	CDD:416386
Ig strand A'	713..717	CDD:409353
Ig strand B	721..727	CDD:409353
Ig strand C	734..739	CDD:409353
Ig strand C'	742..745	CDD:409353
Ig strand D	750..755	CDD:409353
Ig strand E	758..763	CDD:409353
Ig strand F	772..778	CDD:409353
Ig strand G	781..789	CDD:409353
Ig	800..881	CDD:416386
Ig strand A	800..802	CDD:409353
Ig strand A'	805..809	CDD:409353
Ig strand B	813..819	CDD:409353
Ig strand C	826..831	CDD:409353
Ig strand C'	834..837	CDD:409353
Ig strand D	842..847	CDD:409353
Ig strand E	850..855	CDD:409353
Ig strand F	864..870	CDD:409353
Ig strand G	873..881	CDD:409353
Ig	892..973	CDD:416386
Ig strand A	892..894	CDD:409353
Ig strand A'	897..901	CDD:409353
Ig strand B	905..911	CDD:409353
Ig strand C	918..923	CDD:409353
Ig strand C'	926..929	CDD:409353
Ig strand D	934..939	CDD:409353
Ig strand E	942..947	CDD:409353
Ig strand F	956..962	CDD:409353
Ig strand G	965..973	CDD:409353
Ig	984..1065	CDD:416386
Ig strand A	984..986	CDD:409353
Ig strand A'	989..993	CDD:409353
Ig strand B	997..1003	CDD:409353
Ig strand C	1010..1015	CDD:409353
Ig strand C'	1018..1021	CDD:409353
Ig strand D	1026..1031	CDD:409353
Ig strand E	1034..1039	CDD:409353
Ig strand F	1048..1054	CDD:409353
Ig strand G	1057..1065	CDD:409353
Ig	1076..1157	CDD:416386
Ig strand A	1076..1078	CDD:409353
Ig strand A'	1081..1085	CDD:409353
Ig strand B	1089..1095	CDD:409353
Ig strand C	1102..1107	CDD:409353
Ig strand C'	1110..1113	CDD:409353
Ig strand D	1118..1123	CDD:409353
Ig strand E	1126..1131	CDD:409353
Ig strand F	1140..1146	CDD:409353
Ig strand G	1149..1157	CDD:409353
Ig	1168..1249	CDD:416386
Ig strand A	1168..1170	CDD:409353
Ig strand A'	1173..1177	CDD:409353
Ig strand B	1181..1187	CDD:409353
Ig strand C	1194..1199	CDD:409353
Ig strand C'	1202..1205	CDD:409353
Ig strand D	1210..1215	CDD:409353
Ig strand E	1218..1223	CDD:409353
Ig strand F	1232..1238	CDD:409353
Ig strand G	1241..1249	CDD:409353
Ig	1260..1341	CDD:416386
Ig strand A	1260..1262	CDD:409353
Ig strand A'	1265..1269	CDD:409353
Ig strand B	1273..1279	CDD:409353
Ig strand C	1286..1291	CDD:409353
Ig strand C'	1294..1297	CDD:409353
Ig strand D	1302..1307	CDD:409353
Ig strand E	1310..1315	CDD:409353
Ig strand F	1324..1330	CDD:409353
Ig strand G	1333..1341	CDD:409353
Ig	1352..1433	CDD:416386
Ig strand A	1352..1354	CDD:409353
Ig strand A'	1357..1361	CDD:409353
Ig strand B	1365..1371	CDD:409353
Ig strand C	1378..1383	CDD:409353
Ig strand C'	1386..1389	CDD:409353
Ig strand D	1394..1399	CDD:409353
Ig strand E	1402..1407	CDD:409353
Ig strand F	1416..1422	CDD:409353
Ig strand G	1425..1433	CDD:409353
Ig	1444..1525	CDD:416386
Ig strand A	1444..1446	CDD:409353
Ig strand A'	1449..1453	CDD:409353
Ig strand B	1457..1463	CDD:409353
Ig strand C	1470..1475	CDD:409353
Ig strand C'	1478..1481	CDD:409353
Ig strand D	1486..1491	CDD:409353
Ig strand E	1494..1499	CDD:409353
Ig strand F	1508..1514	CDD:409353
Ig strand G	1517..1525	CDD:409353
Ig	1536..1617	CDD:416386
Ig strand A	1536..1538	CDD:409353
Ig strand A'	1541..1545	CDD:409353
Ig strand B	1549..1555	CDD:409353
Ig strand C	1562..1567	CDD:409353
Ig strand C'	1570..1573	CDD:409353
Ig strand D	1578..1583	CDD:409353
Ig strand E	1586..1591	CDD:409353
Ig strand F	1600..1606	CDD:409353
Ig strand G	1609..1617	CDD:409353
Ig	1628..1709	CDD:416386
Ig strand A	1628..1630	CDD:409353
Ig strand A'	1633..1637	CDD:409353
Ig strand B	1641..1647	CDD:409353
Ig strand C	1654..1659	CDD:409353
Ig strand C'	1662..1665	CDD:409353
Ig strand D	1670..1675	CDD:409353
Ig strand E	1678..1683	CDD:409353
Ig strand F	1692..1698	CDD:409353
Ig strand G	1701..1709	CDD:409353
Ig	1720..1801	CDD:416386
Ig strand A	1720..1722	CDD:409353
Ig strand A'	1725..1729	CDD:409353
Ig strand B	1733..1739	CDD:409353
Ig strand C	1746..1751	CDD:409353
Ig strand C'	1754..1757	CDD:409353
Ig strand D	1762..1767	CDD:409353
Ig strand E	1770..1775	CDD:409353
Ig strand F	1784..1790	CDD:409353
Ig strand G	1793..1801	CDD:409353
Ig	1812..1893	CDD:416386
Ig strand A	1812..1814	CDD:409353
Ig strand A'	1817..1821	CDD:409353
Ig strand B	1825..1831	CDD:409353
Ig strand C	1838..1843	CDD:409353
Ig strand C'	1846..1849	CDD:409353
Ig strand D	1854..1859	CDD:409353
Ig strand E	1862..1867	CDD:409353
Ig strand F	1876..1882	CDD:409353
Ig strand G	1885..1893	CDD:409353
Ig	1904..1985	CDD:416386
Ig strand A	1904..1906	CDD:409353
Ig strand A'	1909..1913	CDD:409353
Ig strand B	1917..1923	CDD:409353
Ig strand C	1930..1935	CDD:409353
Ig strand C'	1938..1941	CDD:409353
Ig strand D	1946..1951	CDD:409353
Ig strand E	1954..1959	CDD:409353
Ig strand F	1968..1974	CDD:409353
Ig strand G	1977..1985	CDD:409353
Ig	1996..2077	CDD:416386
Ig strand A	1996..1998	CDD:409353
Ig strand A'	2001..2005	CDD:409353
Ig strand B	2009..2015	CDD:409353
Ig strand C	2022..2027	CDD:409353
Ig strand C'	2030..2033	CDD:409353
Ig strand D	2038..2043	CDD:409353
Ig strand E	2046..2051	CDD:409353
Ig strand F	2060..2066	CDD:409353
Ig strand G	2069..2077	CDD:409353
Ig	2088..2169	CDD:416386
Ig strand A	2088..2090	CDD:409353
Ig strand A'	2093..2097	CDD:409353
Ig strand B	2101..2107	CDD:409353
Ig strand C	2114..2119	CDD:409353
Ig strand D	2404..2409	CDD:409353
Ig strand E	2412..2417	CDD:409353
Ig strand F	2426..2432	CDD:409353
Ig strand G	2435..2443	CDD:409353
Ig	2450..2533	CDD:416386
Ig strand A'	2452..2458	CDD:409353
Ig strand B	2465..2472	CDD:409353
Ig strand C	2477..2482	CDD:409353
Ig strand C'	2484..2487	CDD:409353
Ig strand D	2492..2496	CDD:409353
Ig strand E	2501..2508	CDD:409353
Ig strand F	2515..2523	CDD:409353
Ig	2627..2709	CDD:416386
Ig strand A'	2635..2638	CDD:409353
Ig strand B	2642..2648	CDD:409353
Ig strand C	2654..2659	CDD:409353
Ig strand C'	2662..2665	CDD:409353
Ig strand D	2670..2675	CDD:409353
Ig strand E	2678..2683	CDD:409353
Ig strand F	2692..2698	CDD:409353
Ig strand G	2701..2709	CDD:409353
Ig	2715..2798	CDD:416386
Ig strand B	2731..2735	CDD:409353
Ig strand C	2744..2747	CDD:409353
Ig strand E	2768..2772	CDD:409353
Ig strand F	2782..2787	CDD:409353
Ig	2806..2887	CDD:416386
Ig strand B	2821..2824	CDD:409353
Ig strand C	2832..2836	CDD:409353
Ig strand E	2857..2861	CDD:409353
Ig strand F	2871..2876	CDD:409353
I-set	2983..3066	CDD:400151
Ig strand B	2999..3003	CDD:409353
Ig strand C	3012..3015	CDD:409353
Ig strand E	3036..3040	CDD:409353
Ig strand F	3050..3055	CDD:409353
Ig	3073..3155	CDD:416386
Ig strand A'	3077..3082	CDD:409353
Ig strand B	3088..3094	CDD:409353
Ig strand C	3100..3106	CDD:409353
Ig strand C'	3107..3110	CDD:409353
Ig strand D	3116..3121	CDD:409353
Ig strand E	3124..3134	CDD:409353
Ig strand G	3146..3155	CDD:409353
Ig	3161..3244	CDD:416386
Ig strand B	3177..3181	CDD:409353
Ig strand C	3189..3193	CDD:409353
Ig strand E	3214..3218	CDD:409353
Ig strand F	3228..3233	CDD:409353
Ig	3251..>3319	CDD:416386
Ig strand A'	3255..3260	CDD:409353
Ig strand B	3265..3272	CDD:409353
Ig strand C	3280..3286	CDD:409353
Ig strand C'	3287..3290	CDD:409353
Ig strand D	3295..3301	CDD:409353
Ig strand E	3304..3314	CDD:409353
Ig	3352..3424	CDD:416386
Ig strand B	3356..3362	CDD:409353
Ig strand C	3369..3374	CDD:409353
Ig strand C'	3377..3380	CDD:409353
Ig strand D	3385..3390	CDD:409353
Ig strand E	3393..3398	CDD:409353
Ig strand F	3407..3413	CDD:409353
Ig strand G	3416..3424	CDD:409353
Ig	3430..3513	CDD:416386
Ig strand B	3446..3450	CDD:409353
Ig strand C	3458..3462	CDD:409353
Ig strand E	3483..3487	CDD:409353
Ig	3521..3604	CDD:416386
Ig strand A'	3524..3529	CDD:409353
Ig strand B	3534..3541	CDD:409353
Ig strand C	3548..3554	CDD:409353
Ig strand C'	3555..3558	CDD:409353
Ig strand D	3564..3570	CDD:409353
Ig strand E	3573..3583	CDD:409353
Ig strand G	3593..3604	CDD:409353
I-set	3611..3693	CDD:400151
Ig strand A'	3617..3621	CDD:409353
Ig strand B	3625..3631	CDD:409353
Ig strand C	3638..3643	CDD:409353
Ig strand C'	3646..3649	CDD:409353
Ig strand D	3654..3659	CDD:409353
Ig strand E	3662..3667	CDD:409353
Ig strand F	3676..3682	CDD:409353
Ig strand G	3685..3693	CDD:409353
I-set	3699..3782	CDD:400151
Ig strand A	3701..3704	CDD:409353
Ig strand A'	3706..3709	CDD:409353
Ig strand B	3713..3722	CDD:409353
Ig strand C	3727..3732	CDD:409353
Ig strand C'	3735..3737	CDD:409353
Ig strand D	3743..3748	CDD:409353
Ig strand E	3751..3758	CDD:409353
Ig strand G	3772..3782	CDD:409353
Ig	3788..3870	CDD:416386
Ig strand B	3803..3809	CDD:409353
Ig strand C	3815..3820	CDD:409353
Ig strand C'	3823..3826	CDD:409353
Ig strand D	3831..3836	CDD:409353
Ig strand E	3839..3844	CDD:409353
Ig strand F	3853..3859	CDD:409353
Ig strand G	3862..3870	CDD:409353
Ig	3876..3958	CDD:416386
Ig strand B	3891..3897	CDD:409353
Ig strand C	3903..3908	CDD:409353
Ig strand C'	3911..3914	CDD:409353
Ig strand D	3919..3924	CDD:409353
Ig strand E	3927..3932	CDD:409353
Ig strand F	3941..3947	CDD:409353
Ig strand G	3950..3958	CDD:409353
Ig	3964..4046	CDD:416386
Ig strand B	3979..3985	CDD:409353
Ig strand C	3991..3996	CDD:409353
Ig strand C'	3999..4002	CDD:409353
Ig strand D	4007..4012	CDD:409353
Ig strand E	4015..4020	CDD:409353
Ig strand F	4029..4035	CDD:409353
Ig strand G	4038..4046	CDD:409353
Ig	4052..4134	CDD:416386
Ig strand A'	4055..4061	CDD:409353
Ig strand B	4068..4075	CDD:409353
Ig strand C	4080..4084	CDD:409353
Ig strand C'	4086..4089	CDD:409353
Ig strand D	4094..4098	CDD:409353
Ig strand E	4103..4110	CDD:409353
Ig strand G	4124..4134	CDD:409353
Ig	4140..4222	CDD:416386
Ig strand B	4155..4161	CDD:409353
Ig strand C	4167..4172	CDD:409353
Ig strand C'	4175..4178	CDD:409353
Ig strand D	4183..4188	CDD:409353
Ig strand E	4191..4196	CDD:409353
Ig strand F	4205..4211	CDD:409353
Ig strand G	4214..4222	CDD:409353
Ig	4227..4310	CDD:416386
Ig strand A'	4235..4239	CDD:409353
Ig strand B	4243..4249	CDD:409353
Ig strand C	4255..4260	CDD:409353
Ig strand C'	4263..4266	CDD:409353
Ig strand D	4271..4276	CDD:409353
Ig strand E	4279..4284	CDD:409353
Ig strand F	4293..4299	CDD:409353
Ig strand G	4302..4310	CDD:409353
I-set	4315..4400	CDD:400151
Ig strand A	4315..4317	CDD:409353
Ig strand A'	4319..4325	CDD:409353
Ig strand B	4332..4339	CDD:409353
Ig strand C	4345..4350	CDD:409353
Ig strand D	4360..4364	CDD:409353
Ig strand E	4369..4376	CDD:409353
Ig strand G	4390..4401	CDD:409353
Ig	4405..4488	CDD:416386
Ig strand B	4421..4427	CDD:409353
Ig strand C	4433..4438	CDD:409353
Ig strand C'	4441..4444	CDD:409353
Ig strand D	4449..4454	CDD:409353
Ig strand E	4457..4462	CDD:409353
Ig strand F	4471..4477	CDD:409353
Ig strand G	4480..4488	CDD:409353
Ig	4493..4576	CDD:416386	7/35 (20%)
Ig strand A	4493..4495	CDD:409353
Ig strand A'	4497..4503	CDD:409353
Ig strand B	4510..4517	CDD:409353
Ig strand C	4522..4526	CDD:409353
Ig strand D	4536..4540	CDD:409353
Ig strand E	4545..4552	CDD:409353	2/3 (67%)
Ig strand G	4566..4576	CDD:409353	2/17 (12%)
Ig	4581..4664	CDD:416386	21/132 (16%)
Ig strand B	4597..4603	CDD:409353	1/5 (20%)
Ig strand C	4609..4614	CDD:409353	1/14 (7%)
Ig strand C'	4617..4620	CDD:409353	0/2 (0%)
Ig strand D	4625..4630	CDD:409353	1/4 (25%)
Ig strand E	4633..4638	CDD:409353	1/4 (25%)
Ig strand F	4647..4653	CDD:409353	0/5 (0%)
Ig strand G	4656..4664	CDD:409353	3/28 (11%)
Ig strand A	4668..4671	CDD:409353	2/2 (100%)
Ig	4669..4752	CDD:416386	24/100 (24%)
Ig strand A'	4674..4678	CDD:409353	1/3 (33%)
Ig strand B	4686..4694	CDD:409353	2/7 (29%)
Ig strand C'	4704..4707	CDD:409353	0/2 (0%)
Ig strand D	4713..4718	CDD:409353	0/4 (0%)
Ig strand E	4721..4726	CDD:409353	1/19 (5%)
Ig strand G	4742..4752	CDD:409353	4/10 (40%)
Ig	4757..4840	CDD:416386	19/89 (21%)
Ig strand A'	4765..4769	CDD:409353	1/3 (33%)
Ig strand B	4773..4779	CDD:409353	3/5 (60%)
Ig strand C	4785..4790	CDD:409353	1/8 (13%)
Ig strand C'	4793..4796	CDD:409353	0/2 (0%)
Ig strand D	4801..4806	CDD:409353	1/4 (25%)
Ig strand E	4809..4814	CDD:409353	1/4 (25%)
Ig strand F	4823..4829	CDD:409353	0/5 (0%)
Ig strand G	4832..4840	CDD:409353	0/7 (0%)
Ig	4846..4928	CDD:416386	18/95 (19%)
Ig strand A'	4849..4855	CDD:409353	0/5 (0%)
Ig strand B	4862..4869	CDD:409353	1/6 (17%)
Ig strand C	4874..4878	CDD:409353	0/3 (0%)
Ig strand C'	4880..4883	CDD:409353	1/2 (50%)
Ig strand D	4888..4892	CDD:409353	1/3 (33%)
Ig strand E	4897..4904	CDD:409353	1/6 (17%)
Ig	4934..5017	CDD:416386	17/84 (20%)
Ig strand A	4936..4938	CDD:409353	0/1 (0%)
Ig strand A'	4941..4945	CDD:409353	0/3 (0%)
Ig strand B	4949..4955	CDD:409353	3/5 (60%)
Ig strand C	4962..4967	CDD:409353	0/4 (0%)
Ig strand C'	4970..4973	CDD:409353	0/2 (0%)
Ig strand D	4978..4983	CDD:409353	0/4 (0%)
Ig strand E	4986..4991	CDD:409353	2/4 (50%)
Ig strand F	5000..5006	CDD:409353	1/7 (14%)
Ig strand G	5009..5017	CDD:409353	2/7 (29%)
Ig	5023..5106	CDD:416386	16/71 (23%)
Ig strand B	5038..5044	CDD:409353	2/5 (40%)
Ig strand C	5051..5056	CDD:409353	0/4 (0%)
Ig strand C'	5059..5062	CDD:409353	0/2 (0%)
Ig strand D	5067..5072	CDD:409353	0/4 (0%)
Ig strand E	5075..5080	CDD:409353	3/4 (75%)
Ig strand F	5089..5095	CDD:409353	4/5 (80%)
Ig strand G	5098..5106	CDD:409353
Ig	5123..5197	CDD:416386
Ig strand B	5127..5133	CDD:409353
Ig strand C	5142..5147	CDD:409353
Ig strand C'	5150..5153	CDD:409353
Ig strand D	5158..5163	CDD:409353
Ig strand E	5166..5171	CDD:409353
Ig strand F	5180..5186	CDD:409353
Ig strand G	5189..5197	CDD:409353
Ig	5204..5289	CDD:416386
Ig strand B	5219..5223	CDD:409353
Ig strand C	5232..5236	CDD:409353
Ig strand E	5257..5263	CDD:409353
Ig	5292..5380	CDD:416386
Ig strand A'	5300..5305	CDD:409353
Ig strand B	5310..5317	CDD:409353
Ig strand C	5324..5330	CDD:409353
Ig strand C'	5331..5334	CDD:409353
Ig strand D	5340..5346	CDD:409353
Ig strand E	5349..5359	CDD:409353
Ig strand G	5369..5380	CDD:409353
Ig	5388..5459	CDD:416386
Ig strand A'	5391..5396	CDD:409353
Ig strand B	5401..5408	CDD:409353
Ig strand C	5415..5421	CDD:409353
Ig strand C'	5422..5425	CDD:409353
Ig strand D	5431..5437	CDD:409353
Ig strand E	5440..5450	CDD:409353
Ig_3	5477..5549	CDD:404760
Ig	5566..5651	CDD:416386
Ig	5657..5743	CDD:416386
Ig strand A'	5662..5667	CDD:409353
Ig strand B	5672..5679	CDD:409353
Ig strand C	5687..5693	CDD:409353
Ig strand C'	5694..5697	CDD:409353
Ig strand D	5703..5709	CDD:409353
Ig strand E	5712..5722	CDD:409353
Ig strand F	5726..5734	CDD:409353
FN3	5747..5832	CDD:238020
Ig	5896..5957	CDD:416386
Ig strand B	5902..5908	CDD:409353
Ig strand C	5915..5920	CDD:409353
Ig strand C'	5923..5926	CDD:409353
Ig strand D	5931..5936	CDD:409353
Ig strand E	5939..5944	CDD:409353
I-set	6161..6251	CDD:400151
Ig strand A	6164..6167	CDD:409353
Ig strand A'	6169..6172	CDD:409353
Ig strand B	6176..6185	CDD:409353
Ig strand C	6190..6196	CDD:409353
Ig strand C'	6199..6201	CDD:409353
Ig strand D	6207..6212	CDD:409353
Ig strand E	6215..6223	CDD:409353
Ig strand F	6231..6238	CDD:409353
Ig strand G	6241..6251	CDD:409353
I-set	6391..6481	CDD:400151
Ig strand A	6391..6394	CDD:409353
Ig strand A'	6397..6402	CDD:409353
Ig strand B	6407..6414	CDD:409353
Ig strand C	6421..6427	CDD:409353
Ig strand C'	6428..6431	CDD:409353
Ig strand D	6437..6443	CDD:409353
Ig strand E	6446..6456	CDD:409353
Ig strand F	6460..6468	CDD:409353
Ig strand G	6470..6481	CDD:409353
I-set	6523..6613	CDD:400151
Ig strand A'	6528..6532	CDD:409353
Ig strand B	6540..6549	CDD:409353
Ig strand C	6554..6559	CDD:409353
Ig strand C'	6562..6564	CDD:409353
Ig strand D	6570..6575	CDD:409353
Ig strand E	6578..6583	CDD:409353
Ig strand F	6592..6600	CDD:409353
Ig strand G	6603..6613	CDD:409353
I-set	6634..6729	CDD:400151
Ig strand A	6634..6636	CDD:409353
Ig strand A'	6638..6644	CDD:409353
Ig strand B	6651..6658	CDD:409353
Ig strand C	6664..6669	CDD:409353
Ig strand C'	6671..6674	CDD:409353
Ig strand D	6682..6689	CDD:409353
Ig strand E	6694..6701	CDD:409353
Ig strand F	6708..6716	CDD:409353
SH3_Obscurin_like	6865..6927	CDD:212958
RhoGEF	6960..7136	CDD:413383
PH_Obscurin	7145..7269	CDD:270059
IgI_1_Titin-A168_like	7277..7367	CDD:409563
Ig strand B	7294..7298	CDD:409563
Ig strand C	7307..7311	CDD:409563
Ig strand E	7334..7338	CDD:409563
Ig strand F	7347..7352	CDD:409563
Ig strand G	7360..7363	CDD:409563
Ig_3	7370..7449	CDD:404760
Ig strand A	7370..7373	CDD:409353
Ig strand A'	7376..7380	CDD:409353
Ig strand B	7388..7396	CDD:409353
Ig strand C	7401..7406	CDD:409353
Ig strand C'	7409..7411	CDD:409353
Ig strand D	7417..7422	CDD:409353
Ig strand E	7427..7432	CDD:409353
Ig strand F	7441..7449	CDD:409353
Ig strand G	7452..7462	CDD:409353
I-set	7625..7714	CDD:400151
Ig strand B	7641..7648	CDD:409353
Ig strand C	7655..7661	CDD:409353
Ig strand C'	7662..7665	CDD:409353
Ig strand E	7678..7689	CDD:409353
Ig strand F	7693..7701	CDD:409353
Ig strand G	7703..7714	CDD:409353
PKc_like	7732..7988	CDD:419665
I-set	8705..8787	CDD:400151
Ig strand B	8722..8726	CDD:409353
Ig strand C	8735..8739	CDD:409353
Ig strand E	8760..8765	CDD:409353
Ig strand F	8775..8780	CDD:409353
Ig strand G	8789..8792	CDD:409353
FN3	8799..8877	CDD:214495
PKc_like	8911..9167	CDD:419665
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910