DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and bdl

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:517 Identity:95/517 - (18%)
Similarity:141/517 - (27%) Gaps:219/517 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LILLALLICLPAIRGQAEETSILNSNGTNGRAFQRTQSRREALI----------------PATTQ 58
            |.|||:::             ::|.:.|:.....|.|:..||.:                |....
  Fly    17 LALLAIIL-------------LMNISCTSAARDHRRQTNLEAKVGSHVVFNCYIDFPFDAPIPYL 68

  Fly    59 MAQTLDKASAF----RPTMAAALDAAAPNRSSNNVAINNISNN---GDQRLRLTAALEANLIMSN 116
            :..|.|....|    :.|..:.|         .|..::.:.|:   |...:.|||..|:      
  Fly    69 VHWTKDNKKIFTWYEQETSTSEL---------FNGRLHLVENHPEFGRASVNLTAIRES------ 118

  Fly   117 RNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRP 181
                :|..|.........:.|:..||||:      .:.|...:...|.|..              
  Fly   119 ----DQGWYHCQVSFPNRSPSVRNNGTAY------HLAVQGGSLIRIPPVN-------------- 159

  Fly   182 VATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQ 246
                           |||  :.|..|:..|.:|.......||  .:||.:|          |..|
  Fly   160 ---------------QTI--REGQTAFFHCVMKHPENSQASW--YKDGVLL----------QEVQ 195

  Fly   247 SV---FSPNPERWSLQIKYVQLKDEGTYECQV--------------STEPKASAI---------- 284
            .:   |...|: .||.|....:.|.|.|||:|              :.:.||..|          
  Fly   196 DLVRRFYMGPD-GSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLNIQYKAKVIYAPPEVFLPY 259

  Fly   285 -------VHLRIVEP-------KTELIGES-----------------------------TRHVKA 306
                   .|.|...|       |..|:.:|                             |.:...
  Fly   260 GQPAVLDCHFRANPPLKNLRWEKDGLLFDSYNVPGVFYKMNGSLFFAKVDENHAGSYTCTPYNDL 324

  Fly   307 GSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEI--ERID------------------ 351
            |:......|....|.||:|   ....|.||: .:.|...|:  |.||                  
  Fly   325 GTDGPSPVISVIVLRPPIF---SVTPKAIYI-QKLGEAAELPCEAIDRDGNNRPSIIWGRKDGQP 385

  Fly   352 LPAE--------------------VPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTE 393
            |||:                    :...|.|....|.||.......:..|..|......|||
  Fly   386 LPADRFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMIENIAPRAPYNLTANSTE 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/125 (23%)
V-set 204..290 CDD:284989 27/119 (23%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 17/104 (16%)
Ig 43..131 CDD:299845 17/106 (16%)
I-set 153..242 CDD:254352 27/132 (20%)
Ig 157..242 CDD:299845 26/128 (20%)
Ig_2 252..337 CDD:290606 9/84 (11%)
IG_like 260..327 CDD:214653 8/66 (12%)
I-set 341..428 CDD:254352 18/90 (20%)
IGc2 356..419 CDD:197706 10/62 (16%)
FN3 435..524 CDD:238020 5/13 (38%)
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.