DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CG33543

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:369 Identity:71/369 - (19%)
Similarity:115/369 - (31%) Gaps:121/369 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ILLALLICLPAIRGQAEETSILNSNGTNGRAFQRTQSRREALIPATTQMAQTLDKA-SAFRPTMA 74
            :||.||....||.||.:.|| ...:||.|....|..:...:|.|:|..:...:::: ..|..|:.
  Fly    10 LLLLLLSQNAAILGQLDSTS-SGGSGTGGAPPDRPPTPPLSLQPSTPSITHFVNESFIIFCQTVQ 73

  Fly    75 AALDA-----AAPNRSS-------------------NNVAINNISN-----NGDQRLRLTAALEA 110
            ..:|.     ....|.:                   .::|:.:..|     ||::.         
  Fly    74 KDIDTKWRDPRGQTRENTKGRVHIEKKTTGLLALVFEHIALEDRGNWTCEVNGNRN--------- 129

  Fly   111 NLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTTPTTTTR 175
                .||||..:..:      ..|...:.....:||....:                        
  Fly   130 ----GNRNVNVEREF------LASFELLVNQKISFGKTEQV------------------------ 160

  Fly   176 RTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFI 240
                                 |::  :.|..|.:.|.|:.:....:||| ....:|.||:.|   
  Fly   161 ---------------------QSV--REGRDAMVNCFVEGMPAPEVSWL-YNGEYINTVNST--- 198

  Fly   241 ADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQ----VSTEPKASAIVHLRIVEPKTELIGEST 301
            ...|..:         .|.|:.|...|.|.|.|:    ..|...:..|..|..::.|.......|
  Fly   199 KHNRLSN---------GLYIRNVSQADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNET 254

  Fly   302 ---RHVKAGSQVKLRCIISQAL-EPPLFINWFYNQKQIYLHNRR 341
               ::...|..|.|.|   .|: |||....|.:|.|.|...|.|
  Fly   255 LPVQYAYVGGAVNLSC---DAMGEPPPSFTWLHNNKGIVGFNHR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/95 (24%)
V-set 204..290 CDD:284989 22/89 (25%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 19/71 (27%)
IG_like 256..336 CDD:214653 14/43 (33%)
IGc2 263..327 CDD:197706 14/36 (39%)
FN3 341..445 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.