DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001014616.2 Gene:dpr4 / 3346160 FlyBaseID:FBgn0053512 Length:323 Species:Drosophila melanogaster


Alignment Length:379 Identity:91/379 - (24%)
Similarity:132/379 - (34%) Gaps:173/379 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 IISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYV 263
            :.:..|..|.|.|.|:.|..:.:||:|.||.|||||...|:..||||||:.|...:.|:|:|...
  Fly    55 VTATVGQAALLHCRVRNLGDRAVSWIRKRDLHILTVGILTYTNDQRFQSLHSEGSDEWTLRISSP 119

  Fly   264 QLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW 328
            |.:|.||||||||||||.|....|.:|..:.:::|.:...:|:||.:.|.|:..|:..||.||.|
  Fly   120 QPRDSGTYECQVSTEPKISQGFRLNVVVSRAKILGNAELFIKSGSDINLTCLAMQSPVPPSFIYW 184

  Fly   329 FYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTE 393
             |..|::..:::||                                                   
  Fly   185 -YKGKRVMNYSQRG--------------------------------------------------- 197

  Fly   394 GATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGA 458
                                               |:.|.||.||                    
  Fly   198 -----------------------------------GINVITERST-------------------- 207

  Fly   459 GLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQI 523
                                                                             
  Fly   208 ----------------------------------------------------------------- 207

  Fly   524 TTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIKSGSVSWSAL 577
            .|:.|:|......||||||||||:|...::|:||:|||:.| |::.|:.|.:.|
  Fly   208 RTSKLLIAKATPADSGNYTCSPSSSDSASVVVHVINGEHPA-AMQHGNSSATCL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 43/89 (48%)
V-set 204..290 CDD:284989 43/85 (51%)
dpr4NP_001014616.2 V-set 53..146 CDD:284989 43/90 (48%)
IG_like 53..145 CDD:214653 43/89 (48%)
ig 153..227 CDD:278476 30/245 (12%)
IG_like 161..>227 CDD:214653 29/237 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444713
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.