DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:295 Identity:60/295 - (20%)
Similarity:105/295 - (35%) Gaps:46/295 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ISNNGDQRLRLTAALEANLIMSNRNVQEQHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPA 158
            :..:|::...::.:.|.....|.:..|.....::.|....|.:.:...||..|...    |..||
  Fly     7 VKESGERIADISCSQEHTTKFSPKLSQVAKHRKLAQLEIASGSGLVGLGTGTGTGS----GCGPA 67

  Fly   159 TT----------TTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNV 213
            ..          ..||           .|....:::.....|..:...:.:....|..|...|.|
  Fly    68 IRWQLLLLLLLGNCID-----------LTVSNKISSVGAFEPDFVIPLENVTIAQGRDATFTCVV 121

  Fly   214 KQL-----------VKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKD 267
            ..|           ....::|::.....||.:.:.....:.|. ||...:...|:|.|:.|:::|
  Fly   122 NNLGGHRVSGDGSSAPAKVAWIKADAKAILAIHEHVITNNDRL-SVQHNDYNTWTLNIRGVKMED 185

  Fly   268 EGTYECQVSTEPKASAIVHLRIVEPKTELIGEST---RHVKAGSQVKLRCIISQALEPPLFINWF 329
            .|.|.|||:|:|.......|.:|.| .::|.|.|   ..|..|...||.|......:|.  |.|.
  Fly   186 AGKYMCQVNTDPMKMQTATLEVVIP-PDIINEETSGDMMVPEGGSAKLVCRARGHPKPK--ITWR 247

  Fly   330 YNQ-KQIYLHNRRGWRTEIERIDLPAEVPTTSTTT 363
            ... ::|...|....:|:.:.::  .|:.|.|..|
  Fly   248 REDGREIIARNGSHQKTKAQSVE--GEMLTLSKIT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 24/102 (24%)
V-set 204..290 CDD:284989 24/96 (25%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 25/111 (23%)
ig 102..195 CDD:278476 21/93 (23%)
IG_like 219..307 CDD:214653 15/66 (23%)
Ig 221..307 CDD:299845 15/64 (23%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.