DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Opcml

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_006510497.1 Gene:Opcml / 330908 MGIID:97397 Length:354 Species:Mus musculus


Alignment Length:335 Identity:75/335 - (22%)
Similarity:125/335 - (37%) Gaps:40/335 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRF 245
            ||.:.....|..:|:   :..:.|..|.|.|.:...|.: ::||..  ..||......:..|.|.
Mouse    30 PVRSGDATFPKAMDN---VTVRQGESATLRCTIDDRVTR-VAWLNR--STILYAGNDKWSIDPRV 88

  Fly   246 QSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE--PKASAIVHLRIVEPKTELIGESTRHVKAGS 308
             .:....|.::|:.|:.|.:.|||.|.|.|.|:  ||.|. |||.:..|...:...|...|..||
Mouse    89 -IILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSR-VHLIVQVPPQIMNISSDITVNEGS 151

  Fly   309 QVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVP-------TTSTTTTTT 366
            .|.|.|:.....||.  :.|    :.:.:...:|:.:|.|.::: :::.       ..|......
Mouse   152 SVTLLCLAIGRPEPT--VTW----RHLSVKEGQGFVSEDEYLEI-SDIKRDQSGEYECSALNDVA 209

  Fly   367 TTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGV- 430
            .........|.:..|.......||.:.|.      .|:::...|.:..|..|....:...|.|: 
Mouse   210 APDVRKVKITVNYPPYISKAKNTGVSVGQ------KGILSCEASAVPMAEFQWFKEDTRLATGLD 268

  Fly   431 AVATET-STAQLLTEVEATSSTSG--TSTGAGLLASTSAAYA------AGAAAGITTAATGDSAA 486
            .|..|. .....||....:....|  |......|.:|:|:..      :.|.||......|.::|
Mouse   269 GVRIENKGRISTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYEISPSSAVAGPGAVIDGVNSA 333

  Fly   487 TAATTSAWLT 496
            :.|....||:
Mouse   334 SRALACLWLS 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/93 (30%)
V-set 204..290 CDD:284989 28/87 (32%)
OpcmlXP_006510497.1 Ig 44..132 CDD:416386 28/95 (29%)
Ig strand A' 44..49 CDD:409353 0/7 (0%)
Ig strand B 51..59 CDD:409353 3/7 (43%)
CDR1 59..63 CDD:409353 0/3 (0%)
FR2 64..70 CDD:409353 1/6 (17%)
Ig strand C 64..70 CDD:409353 1/6 (17%)
CDR2 71..83 CDD:409353 2/13 (15%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 11/34 (32%)
Ig strand D 87..94 CDD:409353 1/7 (14%)
Ig strand E 97..103 CDD:409353 1/5 (20%)
Ig strand F 110..118 CDD:409353 4/7 (57%)
CDR3 119..123 CDD:409353 1/3 (33%)
Ig strand G 123..132 CDD:409353 6/9 (67%)
FR4 125..132 CDD:409353 4/7 (57%)
Ig_3 135..206 CDD:404760 15/77 (19%)
Ig strand A 135..138 CDD:409353 1/2 (50%)
Ig strand A' 144..148 CDD:409353 0/3 (0%)
Ig strand B 151..160 CDD:409353 4/8 (50%)
Ig strand C 165..170 CDD:409353 2/10 (20%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 1/7 (14%)
Ig_3 223..300 CDD:404760 16/82 (20%)
putative Ig strand A 224..230 CDD:409353 1/5 (20%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 1/3 (33%)
Ig strand E 279..283 CDD:409353 1/3 (33%)
Ig strand F 293..298 CDD:409353 1/4 (25%)
Ig strand G 306..309 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.