DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP009245

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_553184.3 Gene:AgaP_AGAP009245 / 3291935 VectorBaseID:AGAP009245 Length:203 Species:Anopheles gambiae


Alignment Length:207 Identity:61/207 - (29%)
Similarity:92/207 - (44%) Gaps:42/207 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 DPATTTPTTTTRRTTR--------RPVATTTLKPPPTID--DYQTIISQAGTHAYLPCNVKQLVK 218
            :|.|.||.....:|:.        ...|.:.|...|..|  ..:.:.:..|..|||.|.|:.|..
Mosquito     5 EPHTYTPPKHYYQTSSFDDNEINDDGTAKSPLDRGPYFDISASRNVTALVGNTAYLNCRVRNLGN 69

  Fly   219 KPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASA 283
            :.:||:|.||.|:|||.:.|:.:|||:|||.:|..:.|||::.|.|.:|.|.||||:||.|....
Mosquito    70 RTVSWIRHRDLHLLTVGKATYTSDQRYQSVHNPQLDDWSLKVLYPQQRDSGVYECQISTTPPVGY 134

  Fly   284 IVHLRI----------VEPKTE--------LIGESTRHVKAGSQVKLRCIISQALEPPLFINWFY 330
            .:.|.:          |...||        |:.:..|...:|   |..|:.|.|           
Mosquito   135 SMTLSVEINYDSPRGGVSVITEKGDITTSYLLIQRARSTDSG---KYTCLPSMA----------- 185

  Fly   331 NQKQIYLHNRRG 342
            |...:::|...|
Mosquito   186 NPTTVHVHVLNG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 39/91 (43%)
V-set 204..290 CDD:284989 39/95 (41%)
AgaP_AGAP009245XP_553184.3 Ig 47..140 CDD:299845 39/92 (42%)
IG_like 47..140 CDD:214653 39/92 (42%)
IG_like 127..>180 CDD:214653 11/55 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.