DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr18

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:516 Identity:111/516 - (21%)
Similarity:170/516 - (32%) Gaps:143/516 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLILLALLICLPAIRGQAEETSILNSNGTNGRAFQRTQSRREALIP---ATTQMAQTLDKASAFR 70
            ||:.:||:|   ..:.|...|:.:.:...:.....|....|..|..   .|.....|.|..||.|
  Fly    34 RLLTIALVI---GSQVQVLYTTSVETKSPSASEQSRNGENRSLLFDDYNKTKSTLSTADYLSATR 95

  Fly    71 PTMAAALDAAAPNRSSNNVAINNISNNGDQRLRLTAALEANLIMSNRNVQEQHSYR-ITQDNATS 134
            .|:.|                                      .|:::..|.||.. |...||..
  Fly    96 ATLYA--------------------------------------FSSQDQDEDHSQMPIEASNAPH 122

  Fly   135 AASIAPNGTAFGDAP------------SIPI---GVAPATTTTIDPATTTPTT------TTRRTT 178
              |..|...:.|..|            |:||   |.....||     .|.|||      ..|.|.
  Fly   123 --SPIPTKMSRGKIPMETPGSMEFSSNSLPIKNVGTTDQLTT-----VTMPTTAFASLKVDRSTM 180

  Fly   179 RRPVATTTLKPPPTIDDYQTIISQ-----------------------AG----------THAYLP 210
            ::|:.:|..:...|...:..:..:                       :|          |.|.|.
  Fly   181 KQPIDSTRTRNHWTASGFARVTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLN 245

  Fly   211 CNVKQLVKKPISWLR--MRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYEC 273
            |.|..|..|.:.|:|  .....:|||...|:..|.|.:..|. .|..|.|.|...|.:|.|.|.|
  Fly   246 CRVGMLKDKTVMWVRRTAEKVSLLTVGNVTYSGDPRIRVKFQ-YPNNWRLLINPTQTEDAGVYMC 309

  Fly   274 QVSTEPKASAIVHLRIVEPKTELIGESTRHV-----KAGSQVKLRCIISQALEPPLFINWFYNQK 333
            ||||.|......:|.::||...:|.|..|.|     |:||.|.|:|.||:        ::|..::
  Fly   310 QVSTHPPRVFTTNLTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQISR--------SFFQKER 366

  Fly   334 QIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSS 398
            |..|.:.......::::        .:.||:......:...|....:........|.....|...
  Fly   367 QTILKSTDSANDAVQKL--------INETTSELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDE 423

  Fly   399 ETLNGL----VTITRSYILDAISQNDVS---------ELGAAAGVAVATETSTAQLLTEVE 446
            |.|.|:    ::::..::...||..|..         .||....|.|..:..|.:|...|:
  Fly   424 EPLQGMTNRRLSVSDVWLTSRISIGDAKLSDSGNYSCSLGRLFTVIVQVQVLTGELPAAVQ 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 32/126 (25%)
V-set 204..290 CDD:284989 32/97 (33%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 30/83 (36%)
Ig <258..326 CDD:299845 24/68 (35%)
IGc2 <417..461 CDD:197706 7/43 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.