DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr8

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:242 Identity:87/242 - (35%)
Similarity:125/242 - (51%) Gaps:25/242 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTIDDY--QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNP 253
            ||.|..  ..|....|....|.|.||.|..:.:||:|.||.|:|||.:.|:.:||||:::.||:.
  Fly    42 PTFDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHA 106

  Fly   254 ERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQ 318
            |.|:|:|:|.|.||.|.||||:||.|.....|:|.||||.|::||....|:..||.:.|.||:..
  Fly   107 EDWTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKF 171

  Fly   319 ALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAE--VPTTSTTTTTTTTTAST---TTTTTS 378
            |.|||..:.|.:|::.|...:.||      .|.|..|  |.|||........|..:   |.|.::
  Fly   172 APEPPPTVIWSHNREIINFDSPRG------GISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSN 230

  Fly   379 TTPAT----------PSTTATGSTEGATSSE--TLNGLVTITRSYIL 413
            ..|.:          |:...||:...:|:|:  .|..||.:|.|.::
  Fly   231 ANPTSVRVHIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCSTLM 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 41/91 (45%)
V-set 204..290 CDD:284989 40/85 (47%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 37/79 (47%)
V-set 52..143 CDD:284989 41/90 (46%)
IG_like 153..238 CDD:214653 26/90 (29%)
ig 153..232 CDD:278476 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.