DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Dscaml1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001101611.1 Gene:Dscaml1 / 315615 RGDID:1304887 Length:2111 Species:Rattus norvegicus


Alignment Length:558 Identity:116/558 - (20%)
Similarity:167/558 - (29%) Gaps:191/558 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 NNISNNGDQRLRLTAALEANLIMSNRNVQEQ---HSYRITQDNATSAASIAPNGTAFGDAPSIPI 153
            :.:|...:.|..:|:  ...|.:|  :||::   .:||....:..|..:...||           
  Rat   222 DTVSITPENRFFITS--HGGLYIS--DVQKEDALSTYRCITQHKYSGETRQSNG----------- 271

  Fly   154 GVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVK 218
                |..:..|||.:.||                    .:|.:.:.....|....|||.......
  Rat   272 ----ARLSVTDPAESIPT--------------------ILDGFHSQEVWTGHAVELPCAASGYPI 312

  Fly   219 KPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWS-----LQIKYVQLKDEGTYECQV-ST 277
            ..|.||  :||..|..|                  .||:     |.|..::.:|.|||.|:| :|
  Rat   313 PAIRWL--KDGRPLPAD------------------SRWAKRITGLTISDLRTEDSGTYICEVTNT 357

  Fly   278 EPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRG 342
            ...|.|...|.:::|....:.........||.|.|.|.::.:  |...|.|:.|.:.:       
  Rat   358 FGSAEANGVLTVIDPLHVTLTPKKLKTGIGSTVILSCALTGS--PEFTIRWYRNTELV------- 413

  Fly   343 WRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTI 407
                     ||.|..                                 |..| .|:|||      
  Rat   414 ---------LPGEAI---------------------------------SIRG-LSNETL------ 429

  Fly   408 TRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYA-AG 471
                   .||....|..||....|    |..||...:........||..   :::|.|.... .|
  Rat   430 -------LISSAQKSHSGAYQCFA----TRKAQTAQDFAIIVLEDGTPR---IVSSFSEKVVNPG 480

  Fly   472 AAAGITTAATGDSAATAATTSAWLTTMDAEAAT---TAATTTTTMLPSSSFIKQITTASLIIPAV 533
            ....:..||.|    ....|..|  .:|.|...   :..|...||...::......|...|    
  Rat   481 EQFSLMCAAKG----APPPTVTW--ALDDEPVVRDGSHRTNQYTMSDGTTISHMNVTGPQI---- 535

  Fly   534 VKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIKSGSVSWSA------------LIGCH--GYL 584
              .|.|.|.|:..||        |.:.||.|.....|..|..|            ||.|.  ||.
  Rat   536 --RDGGVYRCTARNS--------VGSAEYQARINVRGPPSIRAMRNITAVAGRDTLINCRVIGYP 590

  Fly   585 HWRNVSTLLTLLWIIKFALA-----RDICQPNATSKAT 617
            ::       ::.| .|.||.     |.:...|.|.|.|
  Rat   591 YY-------SIKW-YKDALLLPDNHRQVVFENGTLKLT 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/97 (26%)
V-set 204..290 CDD:284989 25/91 (27%)
Dscaml1NP_001101611.1 IG 101..173 CDD:214652
IGc2 101..168 CDD:197706
Ig 183..276 CDD:299845 13/72 (18%)
IG_like 195..276 CDD:214653 13/72 (18%)
I-set 291..369 CDD:254352 25/97 (26%)
IGc2 298..359 CDD:197706 22/80 (28%)
IGc2 386..447 CDD:197706 24/129 (19%)
I-set 466..560 CDD:254352 25/116 (22%)
Ig 466..556 CDD:299845 24/112 (21%)
IGc2 577..635 CDD:197706 14/52 (27%)
IG_like 665..744 CDD:214653
Ig 673..739 CDD:143165
I-set 748..843 CDD:254352
Ig7_DSCAM 765..843 CDD:143211
I-set 849..942 CDD:254352
Ig 861..949 CDD:299845
FN3 945..1039 CDD:238020
FN3 1046..1143 CDD:238020
fn3 1151..1237 CDD:278470
FN3 1249..1340 CDD:238020
IGc2 1364..1428 CDD:197706
FN3 1442..1532 CDD:238020
FN3 1546..1618 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.