DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and rst

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001284835.1 Gene:rst / 31290 FlyBaseID:FBgn0003285 Length:764 Species:Drosophila melanogaster


Alignment Length:613 Identity:113/613 - (18%)
Similarity:181/613 - (29%) Gaps:205/613 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QTIISQAGTHAYLPCNV--KQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQ 259
            ||.:  .|....|||.|  ||   ..:.|.:...|...:.|.:.|   :|:..|.|.....:||.
  Fly    37 QTAV--VGARVTLPCRVINKQ---GTLQWTKDDFGLGTSRDLSGF---ERYAMVGSDEEGDYSLD 93

  Fly   260 IKYVQLKDEGTYECQVSTEPKASAIVHLR------IVEPKTELIGE-STRHVKAGSQVKLRCIIS 317
            |..|.|.|:..|:||||..|:....:...      :|.|:...|.: ...:.....:|::.| :|
  Fly    94 IYPVMLDDDARYQCQVSPGPEGQPAIRSTFAGLTVLVPPEAPKITQGDVIYATEDRKVEIEC-VS 157

  Fly   318 QALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAE-----------VPTTSTTTTTTTTTAS 371
            ...:|...|.|......:...|     .|...|.||.:           .|......|..:..|.
  Fly   158 VGGKPAAEITWIDGLGNVLTDN-----IEYTVIPLPDQRRFTAKSVLRLTPKKEHHNTNFSCQAQ 217

  Fly   372 TTTTTT---------------------STTPATPSTTATGSTEGATSSETLNGLV---------- 405
            .|...|                     .:.|.....:..|:..|:....|.:.:|          
  Fly   218 NTADRTYRSAKIRVEVKYAPKVKVNVMGSLPGGAGGSVGGAGGGSVHMSTGSRIVEHSQVRLECR 282

  Fly   406 ------------------------------TITRSYILDAISQNDVSELGAAAGVAVATET---- 436
                                          .:||.: .|||.:.:|..   :.|.:..:||    
  Fly   283 ADANPSDVRYRWFINDEPIIGGQKTEMVIRNVTRKF-HDAIVKCEVQN---SVGKSEDSETLDIS 343

  Fly   437 -----------------STAQLLTEVEA------------TSSTSGTSTGAGLLASTSAA---YA 469
                             |...|..||::            :....||||......|...|   |.
  Fly   344 YAPSFRQRPQSMEADVGSVVSLTCEVDSNPQPEIVWIQHPSDRVVGTSTNLTFSVSNETAGRYYC 408

  Fly   470 AGAAAGITTAAT-------GDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTA- 526
            .....|....:.       |..|..:..|...|....|.....|::.......|.:|..|..:: 
  Fly   409 KANVPGYAEISADAYVYLKGSPAIGSQRTQYGLVGDTARIECFASSVPRARHVSWTFNGQEISSE 473

  Fly   527 -----SLIIPAV--------VKLDS-----GNYTCSPSNSAPRTIVLHVLNGEYSASAIKS--GS 571
                 |:::.||        :..||     |.|.|:..|.....:....|..:.|.|.:.:  |.
  Fly   474 SGHDYSILVDAVPGGVKSTLIIRDSQAYHYGKYNCTVVNDYGNDVAEIQLQAKKSVSLLMTIVGG 538

  Fly   572 VSWSALIGCHGYLHWRNVSTLLTLLWIIKFALARDICQPNATSKATTRTSLLRAGDGATADVTRE 636
            :|..|.:         .|.|:|.:::|                |...||.|      ..|||..|
  Fly   539 ISVVAFL---------LVLTILVVVYI----------------KCKKRTKL------PPADVISE 572

  Fly   637 TGPKSGASFHRVSSS--ISATKVAEDKT 662
                     |:::.:  :|......|:|
  Fly   573 ---------HQITKNGGVSCKLEPGDRT 591

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/99 (28%)
V-set 204..290 CDD:284989 26/93 (28%)
rstNP_001284835.1 IG_like 34..130 CDD:214653 28/100 (28%)
Ig 42..114 CDD:299845 25/77 (32%)
C2-set_2 135..225 CDD:285423 17/95 (18%)
Ig_3 265..329 CDD:290638 8/64 (13%)
I-set 346..420 CDD:254352 12/73 (16%)
Ig 360..425 CDD:299845 12/64 (19%)
Ig5_KIRREL3-like 428..524 CDD:143235 18/95 (19%)
IG_like 435..524 CDD:214653 16/88 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.