DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Lrig2

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001101180.1 Gene:Lrig2 / 310753 RGDID:1309554 Length:1054 Species:Rattus norvegicus


Alignment Length:381 Identity:71/381 - (18%)
Similarity:119/381 - (31%) Gaps:101/381 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VAINNISNNGDQRLRLTAALEANLIMSNRNVQEQHSY-RITQDNATSAASIAPNGTAFGDAPSIP 152
            :..|:..:|..|:.:||             |.|..|: :...|......::|....|....|:  
  Rat   580 IVTNHFGSNYSQKAKLT-------------VNEMPSFLKTPMDLTIRTGAMARLECAAEGHPT-- 629

  Fly   153 IGVAPATTTTIDPATTTPTTTTRRTTRRP--------------------------------VATT 185
                |..:...|..|..|....||....|                                .:.|
  Rat   630 ----PQISWQKDGGTDFPAARERRMHVMPEDDVFFIANVKIEDMGIYSCMAQNIAGGLSANASLT 690

  Fly   186 TLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFS 250
            .|:.|..|...:......|..|.|.|.........::|.: .||.:|..::..|.|..:.     
  Rat   691 VLETPSFIRPLEDKTVTRGETAVLQCIAGGSPAPRLNWTK-DDGPLLVTERHFFAAANQL----- 749

  Fly   251 PNPERWSLQIKYVQLKDEGTYECQVS-TEPKASAIVHLRIV-EPKTELIGESTRHVKAGSQ---- 309
                   |.|....|:|.|.|.|.:| |.......::|.:: .|..:....|..|...|..    
  Rat   750 -------LIIVDAGLEDAGKYTCLMSNTLGTERGHIYLNVISSPNCDSSQNSIGHEDDGWTTVGI 807

  Fly   310 ---VKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWR----TEIERIDLPAEVPTTSTTTTTTT 367
               |.:.|::..:|      .|..    :..|.||...    |..|.::|||::|:..::..|.:
  Rat   808 VIIVVVCCVVGTSL------IWVI----VIYHMRRKDEDYSITNTEELNLPADIPSYLSSQGTLS 862

  Fly   368 T-----TASTTTTTTSTTPATPSTTATGSTEGATSSETL-------NGLVTITRSY 411
            .     :.|...:.....|.....|..| |:|.|.:..:       ..:.:.||.|
  Rat   863 EPQEGYSNSEAGSHQQLMPPASGYTHKG-TDGGTGTRVICSDCYDNANIYSRTREY 917

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 20/92 (22%)
V-set 204..290 CDD:284989 20/86 (23%)
Lrig2NP_001101180.1 LRR_RI <50..204 CDD:238064
leucine-rich repeat 98..120 CDD:275380
LRR_8 119..178 CDD:290566
leucine-rich repeat 121..144 CDD:275380
LRR_RI 136..398 CDD:238064
leucine-rich repeat 145..167 CDD:275380
LRR_8 167..226 CDD:290566
leucine-rich repeat 168..192 CDD:275380
leucine-rich repeat 193..215 CDD:275380
leucine-rich repeat 216..239 CDD:275380
LRR_8 239..298 CDD:290566
leucine-rich repeat 240..263 CDD:275380
leucine-rich repeat 264..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
LRR_8 311..370 CDD:290566
leucine-rich repeat 312..335 CDD:275380
leucine-rich repeat 336..359 CDD:275380
LRR_8 358..421 CDD:290566
leucine-rich repeat 360..384 CDD:275380
LRR_4 385..426 CDD:289563
leucine-rich repeat 387..410 CDD:275380
leucine-rich repeat 411..433 CDD:275380
LRRCT 444..492 CDD:214507
Ig 501..597 CDD:299845 5/29 (17%)
IG 503..597 CDD:214652 5/29 (17%)
I-set 601..691 CDD:254352 12/95 (13%)
Ig_1 618..692 CDD:143240 11/79 (14%)
I-set 695..782 CDD:254352 22/99 (22%)
Ig 713..782 CDD:299845 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.