DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_038944182.1 Gene:Lsamp / 29561 RGDID:71102 Length:378 Species:Rattus norvegicus


Alignment Length:338 Identity:78/338 - (23%)
Similarity:124/338 - (36%) Gaps:57/338 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 AFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAY 208
            ||.:.|...:.::|.|.    |.....:....|.|                  ..|..:.|..|.
  Rat    25 AFWNQPPAEVNLSPITI----PGLPVRSVDFNRGT------------------DNITVRQGDTAI 67

  Fly   209 LPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYEC 273
            |.|.|:....| ::||. |.| |:......:..|.|.: :...:...:||:|:.|.:.|||:|.|
  Rat    68 LRCVVEDKNSK-VAWLN-RSG-IIFAGHDKWSLDPRVE-LEKRHALEYSLRIQKVDVYDEGSYTC 128

  Fly   274 QVST--EPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW-------- 328
            .|.|  |||.|.:..:..|.||...|..... |..||.|.|.|:.:...||  .|.|        
  Rat   129 SVQTQHEPKTSQVYLIVQVPPKISNISSDVT-VNEGSNVTLVCMANGRPEP--VITWRHLTPLGR 190

  Fly   329 -FYNQKQIYLHNRRGWRTEIERIDLPA--EVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATG 390
             |..::: ||......|.:..:.:..|  ||.:........|.....|.|.:.:..||....|:.
  Rat   191 EFEGEEE-YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQASL 254

  Fly   391 STEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAV-ATETSTAQLLTEVEATSSTSGT 454
            ..|.:.....             |.....|.:.:.:|.|:.: :||..::..:|.|......:.|
  Rat   255 KCEASAVPAP-------------DFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYGNYT 306

  Fly   455 STGAGLLASTSAA 467
            ...|..|..|:|:
  Rat   307 CVAANKLGVTNAS 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/93 (31%)
V-set 204..290 CDD:284989 28/87 (32%)
LsampXP_038944182.1 Ig 55..145 CDD:416386 30/111 (27%)
FR1 55..71 CDD:409353 5/33 (15%)
Ig strand A' 56..62 CDD:409353 1/5 (20%)
Ig strand B 64..72 CDD:409353 3/7 (43%)
CDR1 72..76 CDD:409353 1/3 (33%)
FR2 77..84 CDD:409353 3/8 (38%)
Ig strand C 77..83 CDD:409353 2/6 (33%)
CDR2 85..95 CDD:409353 2/10 (20%)
Ig strand C' 87..90 CDD:409353 1/2 (50%)
Ig strand C' 92..95 CDD:409353 0/2 (0%)
FR3 96..131 CDD:409353 11/35 (31%)
Ig strand D 100..107 CDD:409353 1/7 (14%)
Ig strand E 110..116 CDD:409353 2/5 (40%)
Ig strand F 123..131 CDD:409353 4/7 (57%)
CDR3 132..136 CDD:409353 1/3 (33%)
Ig strand G 136..145 CDD:409353 3/8 (38%)
FR4 138..145 CDD:409353 1/6 (17%)
Ig_3 148..218 CDD:404760 18/73 (25%)
Ig strand A' 155..160 CDD:409353 0/5 (0%)
Ig strand B 166..173 CDD:409353 3/6 (50%)
Ig strand C 179..184 CDD:409353 2/4 (50%)
Ig strand D 190..193 CDD:409353 0/2 (0%)
Ig strand E 197..203 CDD:409353 2/6 (33%)
Ig strand F 210..217 CDD:409353 0/6 (0%)
Ig strand G 224..232 CDD:409353 0/7 (0%)
Ig_3 235..311 CDD:404760 15/88 (17%)
Ig strand B 252..256 CDD:409353 1/3 (33%)
Ig strand C 265..269 CDD:409353 1/3 (33%)
Ig strand E 290..294 CDD:409353 0/3 (0%)
Ig strand F 304..309 CDD:409353 1/4 (25%)
Ig strand G 318..321 CDD:409353 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.