DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and dpr7

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:260 Identity:73/260 - (28%)
Similarity:108/260 - (41%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 PTIDDY--QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNP 253
            |..||.  :.:.:.....|.|.|.||....:.:||:|.||.||||.:..|:..||||..:..|..
  Fly    51 PFFDDISPRNVSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGS 115

  Fly   254 ERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIV------------------EPKTELIGES 300
            |.|.|:|.|.|.:|.|.|||||:||||.:..:.|:::                  ..:.:::|.:
  Fly   116 EDWDLKIDYAQPRDSGVYECQVNTEPKINLAICLQVIADNDFQDLKTKKRFYDTKSARAKILGST 180

  Fly   301 TRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTT 365
            ..|||..|.:.|.|.::  :..|..| |::....:...:.||      .|.|..|.....||:..
  Fly   181 EIHVKRDSTIALACSVN--IHAPSVI-WYHGSSVVDFDSLRG------GISLETEKTDVGTTSRL 236

  Fly   366 TTTTAST------TTTTTSTTPA-------TPSTTATGSTEGATSSETLNGLVTITRSYILDAIS 417
            ..|.||.      |.......||       |....|...|..|........::||..:.:|..||
  Fly   237 MLTRASLRDSGNYTCVPNGAIPASVRVHVLTGEQPAAMQTSSAIRIRAFTAMITIISTKVLLYIS 301

  Fly   418  417
              Fly   302  301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 38/91 (42%)
V-set 204..290 CDD:284989 38/85 (45%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 37/88 (42%)
IG_like 58..140 CDD:214653 33/81 (41%)
IG_like 179..265 CDD:214653 22/94 (23%)
Ig 187..257 CDD:299845 17/78 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.