DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Lsamp

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:341 Identity:81/341 - (23%)
Similarity:129/341 - (37%) Gaps:49/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 AFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTID---DYQTIISQAGT 205
            ||.:.|...:.::|.|.    |.       |..|.|:........|..::|   ....|..:.|.
Mouse    25 AFWNQPPAEVNLSPITI----PG-------TEETMRKKAKEEEGLPVRSVDFNRGTDNITVRQGD 78

  Fly   206 HAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGT 270
            .|.|.|.|:....| ::||. |.| |:......:..|.|.: :...:...:||:|:.|.:.|||:
Mouse    79 TAILRCVVEDKNSK-VAWLN-RSG-IIFAGHDKWSLDPRVE-LEKRHALEYSLRIQKVDVYDEGS 139

  Fly   271 YECQVST--EPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINW----- 328
            |.|.|.|  |||.|.:..:..|.||...|..... |..||.|.|.|:.:...||  .|.|     
Mouse   140 YTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVT-VNEGSNVTLVCMANGRPEP--VITWRHLTP 201

  Fly   329 ----FYNQKQIYLHNRRGWRTEIERIDLPA--EVPTTSTTTTTTTTTASTTTTTTSTTPATPSTT 387
                |..::: ||......|.:..:.:..|  ||.:........|.....|.|.:.:..||....
Mouse   202 LGREFEGEEE-YLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEATTGRQ 265

  Fly   388 ATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAV-ATETSTAQLLTEVEATSST 451
            |:...|.:.....             |.....|.:.:.:|.|:.: :||..::..:|.|......
Mouse   266 ASLKCEASAVPAP-------------DFEWYRDDTRINSANGLEIKSTEGQSSLTVTNVTEEHYG 317

  Fly   452 SGTSTGAGLLASTSAA 467
            :.|...|..|..|:|:
Mouse   318 NYTCVAANKLGVTNAS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/93 (31%)
V-set 204..290 CDD:284989 28/87 (32%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 29/93 (31%)
Ig_3 163..232 CDD:372822 18/72 (25%)
Ig_3 250..325 CDD:372822 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.