DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and MDGA1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens


Alignment Length:605 Identity:116/605 - (19%)
Similarity:183/605 - (30%) Gaps:190/605 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 DKASAFR-------PTMAAALDAAAPNRSSNNVAINNISNNGDQRLRLTAALEANLIMSNRNVQE 121
            |||..||       |.:..:::.........||.:..:...||...:|               |.
Human   226 DKAITFRLTNTTAPPALKLSVNETLVVNPGENVTVQCLLTGGDPLPQL---------------QW 275

  Fly   122 QHSYRITQDNATSAASIAPNGTAFGDAPSIPIGVA--------PATTTTIDPATTTPTTTTRRTT 178
            .|.     .......::|..||.     |||...|        .||....:||..|.....|...
Human   276 SHG-----PGPLPLGALAQGGTL-----SIPSVQARDSGYYNCTATNNVGNPAKKTVNLLVRSMK 330

  Fly   179 RRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIA-- 241
            ......|    |..|.:.:.|  |.|....|.|:|..:.::.:::...::|....:.:...:.  
Human   331 NATFQIT----PDVIKESENI--QLGQDLKLSCHVDAVPQEKVTYQWFKNGKPARMSKRLLVTRN 389

  Fly   242 DQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVS----TEPKASAIVHL-------RIVEPKTE 295
            |....:|.|      ||::..:...|.|||.|..|    ..|..|..|::       .|..||  
Human   390 DPELPAVTS------SLELIDLHFSDYGTYLCMASFPGAPVPDLSVEVNISSETVPPTISVPK-- 446

  Fly   296 LIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGW-RTEIERIDLPAEVPTT 359
              |.:...|:.||..:|:|.:.....||:.                 | |.:.|...||:.:|. 
Human   447 --GRAVVTVREGSPAELQCEVRGKPRPPVL-----------------WSRVDKEAALLPSGLPL- 491

  Fly   360 STTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSEL 424
                                     ..|..|.......|..::|      :|.......|..:..
Human   492 -------------------------EETPDGKLRLERVSRDMSG------TYRCQTARYNGFNVR 525

  Fly   425 GAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAA 489
            ...|.|.:     ..|...|||.:|.....:.|..:|...|  ...|:...|.:|          
Human   526 PREAQVQL-----NVQFPPEVEPSSQDVRQALGRPVLLRCS--LLRGSPQRIASA---------- 573

  Fly   490 TTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITT----ASLIIPAVVKLDSGNYTCSPSNSAP 550
               .|             .....:||....:.....    |.|.:.||.:..||:|.||.||...
Human   574 ---VW-------------RFKGQLLPPPPVVPAAAEAPDHAELRLDAVTRDSSGSYECSVSNDVG 622

  Fly   551 RTIVLHVLNGE-YS-------ASAIKSGSVSWSALIGCHGYLHWRNVSTLLTLLW---------- 597
            ....|..::.: ||       .:..:|..:|             :|.|.:|.  |          
Human   623 SAACLFQVSAKAYSPEFYFDTPNPTRSHKLS-------------KNYSYVLQ--WTQREPDAVDP 672

  Fly   598 IIKFALA-RDICQPNATSKA 616
            ::.:.|: |.:.|.||..||
Human   673 VLNYRLSIRQLNQHNAVVKA 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 21/104 (20%)
V-set 204..290 CDD:284989 19/98 (19%)
MDGA1XP_006715119.1 IG_like 46..126 CDD:214653
IGc2 52..115 CDD:197706
IG_like 152..217 CDD:214653
Ig 153..217 CDD:143165
IG_like 248..326 CDD:214653 19/102 (19%)
IGc2 254..315 CDD:197706 16/85 (19%)
IGc2 350..418 CDD:197706 15/73 (21%)
IG_like 450..535 CDD:214653 21/138 (15%)
IGc2 455..515 CDD:197706 17/108 (16%)
Ig 541..622 CDD:299845 23/108 (21%)
IG_like 543..631 CDD:214653 22/115 (19%)
MAM 753..917 CDD:279023
MAM 753..916 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.