DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and LRIG1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_056356.2 Gene:LRIG1 / 26018 HGNCID:17360 Length:1093 Species:Homo sapiens


Alignment Length:392 Identity:81/392 - (20%)
Similarity:121/392 - (30%) Gaps:110/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PATTQMAQTLDKASAFRPTMAAALDAAAP--------NRSSNNVAINNI----SNNGDQRLRLTA 106
            |.||......|    .|.|.:||..:::|        |....|..:.|.    :.:|:       
Human   501 PETTMAMVGKD----IRFTCSAASSSSSPMTFAWKKDNEVLTNADMENFVHVHAQDGE------- 554

  Fly   107 ALEANLIMSNRNVQEQHSYRITQDNATSAASIAPN--GTAFGDAPSIPIGVAPATTTTIDPATTT 169
            .:|...|:..|.|...|..|.        ..:..|  |:.:.....:.:.|.|:       .|.|
Human   555 VMEYTTILHLRQVTFGHEGRY--------QCVITNHFGSTYSHKARLTVNVLPS-------FTKT 604

  Fly   170 PTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDG----- 229
            |...|.|||                          |.|.|.|.........|:|  .:||     
Human   605 PHDITIRTT--------------------------TMARLECAATGHPNPQIAW--QKDGGTDFP 641

  Fly   230 -------HILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQV-STEPKASAIVH 286
                   |::..|...||.|                    |::.|.|.|.|.. ::....||...
Human   642 AARERRMHVMPDDDVFFITD--------------------VKIDDAGVYSCTAQNSAGSISANAT 686

  Fly   287 LRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERI- 350
            |.::|..:.::....|.|..|..|.|:|  .....||..|.||...:.:.|..|.....:.:.: 
Human   687 LTVLETPSLVVPLEDRVVSVGETVALQC--KATGNPPPRITWFKGDRPLSLTERHHLTPDNQLLV 749

  Fly   351 --DLPAEVPTTSTTTTTTTTTASTTTTTTSTTPAT----PSTTATGSTEGATSSETLNGLVTITR 409
              ::.||.....|...:.|.......:..|..||.    ..||....|....||..|..||.:..
Human   750 VQNVVAEDAGRYTCEMSNTLGTERAHSQLSVLPAAGCRKDGTTVGIFTIAVVSSIVLTSLVWVCI 814

  Fly   410 SY 411
            .|
Human   815 IY 816

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 21/104 (20%)
V-set 204..290 CDD:284989 21/98 (21%)
LRIG1NP_056356.2 leucine-rich repeat 51..69 CDD:275380
LRR_RI <53..176 CDD:238064
leucine-rich repeat 70..93 CDD:275380
LRR_8 71..127 CDD:290566
leucine-rich repeat 117..140 CDD:275378
LRR_RI 131..416 CDD:238064
LRR_8 140..223 CDD:290566
leucine-rich repeat 141..164 CDD:275380
leucine-rich repeat 165..197 CDD:275380
LRR_8 211..271 CDD:290566
leucine-rich repeat 213..236 CDD:275380
leucine-rich repeat 237..260 CDD:275380
LRR_8 259..319 CDD:290566
leucine-rich repeat 261..284 CDD:275380
leucine-rich repeat 285..308 CDD:275380
LRR_8 308..367 CDD:290566
leucine-rich repeat 309..332 CDD:275380
leucine-rich repeat 333..356 CDD:275380
leucine-rich repeat 357..381 CDD:275380
LRR_8 383..442 CDD:290566
leucine-rich repeat 384..405 CDD:275380
leucine-rich repeat 408..431 CDD:275380
LRRCT 442..490 CDD:214507
I-set 495..595 CDD:254352 21/112 (19%)
Ig 512..586 CDD:143165 17/88 (19%)
I-set 599..689 CDD:254352 29/144 (20%)
Ig_1 616..690 CDD:143240 20/95 (21%)
I-set 693..780 CDD:254352 17/88 (19%)
IGc2 707..770 CDD:197706 15/64 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.