DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CADM1

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_016872946.1 Gene:CADM1 / 23705 HGNCID:5951 Length:477 Species:Homo sapiens


Alignment Length:453 Identity:86/453 - (18%)
Similarity:136/453 - (30%) Gaps:161/453 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 TTRRTTRRPVATTTLKPPPTIDDYQTIISQ-----AGTHAYLPCNVKQLVKKPISWLRMRDGHIL 232
            |.::|.:|...........|..|.|.:.::     .|..|.:.|.|.   |...|.:::.:.:..
Human    27 TQQKTVQRSAPIAMKASGHTSGDGQNLFTKDVTVIEGEVATISCQVN---KSDDSVIQLLNPNRQ 88

  Fly   233 TVDQTTF--IADQRFQSV-FSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKT 294
            |:....|  :.|.|||.: ||.:..:.||  ..|.:.|||.|.||:.|:|...:...:.::.|..
Human    89 TIYFRDFRPLKDSRFQLLNFSSSELKVSL--TNVSISDEGRYFCQLYTDPPQESYTTITVLVPPR 151

  Fly   295 ELIGESTRHVKA-GSQVKLRCIISQALEPPLFINWFYN--------------------------- 331
            .|:.:..:.... |.::::.| .:.|.:|...|.||..                           
Human   152 NLMIDIQKDTAVEGEEIEVNC-TAMASKPATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKV 215

  Fly   332 ----------------------QKQIYLH------------------NRRG-------------- 342
                                  |.|.||.                  .|.|              
Human   216 HKEDDGVPVICQVEHPAVTGNLQTQRYLEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQ 280

  Fly   343 ------------------------------------WRTEIERI-------------DLPAEVPT 358
                                                :|.|...|             |.|..:|.
Human   281 PVMVTWVRVDDEMPQHAVLSGPNLFINNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDPPTTIPP 345

  Fly   359 TSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGL-VTITRSYILDAISQNDVS 422
            .:|||||||||.:|..|..:.|.||......|.|:...|:|.|:.. ::.:|:....:|...|.:
Human   346 PTTTTTTTTTTTTTILTIITDTTATTEPAVHGLTQLPNSAEELDSEDLSDSRAGEEGSIRAVDHA 410

  Fly   423 ELGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSA 485
            .:|....|.|........:|               ....|.....|....|.|...||..|:|
Human   411 VIGGVVAVVVFAMLCLLIIL---------------GRYFARHKGTYFTHEAKGADDAADADTA 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/99 (26%)
V-set 204..290 CDD:284989 25/88 (28%)
CADM1XP_016872946.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.