DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_011240777.1 Gene:Igsf9b / 235086 MGIID:2685354 Length:1443 Species:Mus musculus


Alignment Length:346 Identity:71/346 - (20%)
Similarity:107/346 - (30%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 KAGSQVKLRCIISQAL---EPPLFINWF-------------YNQKQI--------YLHNRRGWRT 345
            :||..|.|||.:...:   .||..:.||             |....:        .||::...|.
Mouse    38 RAGEGVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRL 102

  Fly   346 EIER--------------------------IDLPAEVPTTSTTTTTTTTTAST--TTTTTSTTPA 382
            |..|                          :.|....|.|.|.|......|..  :.|.|.|...
Mouse   103 EQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFG 167

  Fly   383 TPSTTAT----GSTEGATSS-ETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLL 442
            .|....|    |:..||::. :..:|.:|:|      ::|:.|.......|.........|..||
Mouse   168 NPKPIVTWLKEGTLLGASAKYQVSDGSLTVT------SVSREDRGAYTCRAYSIQGEAVHTTHLL 226

  Fly   443 TEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAA 507
            .:                    ...:.......||...:.|:          |.|..|||.....
Mouse   227 VQ--------------------GPPFIVSPPENITVNISQDA----------LLTCRAEAYPGNL 261

  Fly   508 TTTTTMLPSSSF--------IKQITTASLIIPAVVKLDSGNYTCSPSNSAPRT-IVLHVLNGEYS 563
            |.|......:.:        ::.:...:|||..|...|:|.|||.||||..|: .....|..:|.
Mouse   262 TYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDAGKYTCVPSNSLGRSPSASAYLTVQYP 326

  Fly   564 ASAIKSGSVSWSALIGCHGYL 584
            |..:....|.: ..:|.|||:
Mouse   327 ARVLNMPPVIY-VPVGIHGYI 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653
V-set 204..290 CDD:284989
Igsf9bXP_011240777.1 Ig 43..117 CDD:319273 14/73 (19%)
I-set 141..227 CDD:369462 20/91 (22%)
Ig 231..323 CDD:386229 25/101 (25%)
Ig <355..416 CDD:386229
Ig 440..504 CDD:319273
FN3 512..607 CDD:238020
FN3 623..705 CDD:238020
PHA03247 <900..1248 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.