DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:346 Identity:72/346 - (20%)
Similarity:106/346 - (30%) Gaps:103/346 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 KAGSQVKLRCIISQAL---EPPLFINWF-------------YNQKQI--------YLHNRRGWRT 345
            :||..|.|||.:...:   .||..:.||             |....:        .||::...|.
Human    36 RAGESVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLRL 100

  Fly   346 EIER--------------------------IDLPAEVPTTSTTTTTTTTTAST--TTTTTSTTPA 382
            |..|                          :.|....|.|.|.|......|..  :.|.|.|...
Human   101 EQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTINAPPTFTETPPQYIEAKEGGSITMTCTAFG 165

  Fly   383 TPSTTAT----GSTEGATSS-ETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLL 442
            .|....|    |:..||:.. :..:|.:|:|      ::|:.|.......|.........|..||
Human   166 NPKPIVTWLKEGTLLGASGKYQVSDGSLTVT------SVSREDRGAYTCRAYSIQGEAVHTTHLL 224

  Fly   443 TEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAATTAA 507
            .:                    ...:.......||...:.|:          |.|..|||.....
Human   225 VQ--------------------GPPFIVSPPENITVNISQDA----------LLTCRAEAYPGNL 259

  Fly   508 TTTTTMLPSSSF--------IKQITTASLIIPAVVKLDSGNYTCSPSNSAPRT-IVLHVLNGEYS 563
            |.|......:.:        ::.:...:|||..|...|||.|||.||||..|: .....|..:|.
Human   260 TYTWYWQDENVYFQNDLKLRVRILIDGTLIIFRVKPEDSGKYTCVPSNSLGRSPSASAYLTVQYP 324

  Fly   564 ASAIKSGSVSWSALIGCHGYL 584
            |..:....|.: ..:|.|||:
Human   325 ARVLNMPPVIY-VPVGIHGYI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653
V-set 204..290 CDD:284989
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 16/78 (21%)
Ig 41..115 CDD:143165 14/73 (19%)
I-set 139..225 CDD:254352 20/91 (22%)
IGc2 153..210 CDD:197706 13/62 (21%)
I-set 229..321 CDD:254352 26/101 (26%)
Ig 235..321 CDD:299845 26/95 (27%)
IG_like 331..414 CDD:214653 5/15 (33%)
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.