Protein Alignment dpr15 and Unc5d

DIOPT Version :9

• Sequence 1: NP_001287299.1
• Gene: dpr15 / 41473
• FlyBaseID: FBgn0037993
• Length: 662
• Species: Drosophila melanogaster
• Sequence 2: NP_694775.1
• Gene: Unc5d / 210801
• MGIID: 2389364
• Length: 956
• Species: Mus musculus
• Alignment Length: 55
• Identity: 20/55 - (36%)
• Similarity: 28/55 - (50%)
• Gaps: 11/55 - (20%)

  Fly   527 SLIIPAVVKLDSGNYTCSPSN------SAPRTIVLHVLNG-----EYSASAIKSG 570
            :|||......|||||||..:|      |...|:|::|..|     |:||..::.|
Mouse   213 NLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNVRCG 267

Known Domains

Gene	Sequence	Domain	Region	External ID	Identity
dpr15	NP_001287299.1	IG_like	197..289	CDD:214653
		V-set	204..290	CDD:284989
Unc5d	NP_694775.1	Ig	51..153	CDD:299845
		Important for interaction with FLRT2. /evidence=ECO:0000250|UniProtKB:F1LW30	89..91
		I-set	159..247	CDD:254352	13/33 (39%)
		Ig	161..247	CDD:299845	13/33 (39%)
		TSP1	253..304	CDD:214559	4/15 (27%)
		TSP1	309..357	CDD:214559
		ZU5	545..640	CDD:279170
		Death_UNC5D	856..953	CDD:176779

Information from Original Tools

Tool	Simple Score	Weighted Score	Original Tool Information
			BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910