DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CADM4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_660339.1 Gene:CADM4 / 199731 HGNCID:30825 Length:388 Species:Homo sapiens


Alignment Length:421 Identity:80/421 - (19%)
Similarity:146/421 - (34%) Gaps:131/421 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 ISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVD----QTTF------IADQRFQ-SVFSPNP 253
            :::.|. |.:.|.:.|.           ||.|:.:.    ||.|      :.|:||| ..||  |
Human    34 VAEGGV-AEITCRLHQY-----------DGSIVVIQNPARQTLFFNGTRALKDERFQLEEFS--P 84

  Fly   254 ERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRI-VEPKTELIGESTRHVKAGSQVKLRCIIS 317
            .|..:::...:|:|||.|.||:.||.....|..|.: |.|:..:: |.......|.:|:|.|::.
Human    85 RRVRIRLSDARLEDEGGYFCQLYTEDTHHQIATLTVLVAPENPVV-EVREQAVEGGEVELSCLVP 148

  Fly   318 QALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPA 382
            :: .|...:.|:.::|::                                               
Human   149 RS-RPAATLRWYRDRKEL----------------------------------------------- 165

  Fly   383 TPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTA-------- 439
                      :|.:||:. ||.|....|.:...:.:.|      ..|:.:....:.|        
Human   166 ----------KGVSSSQE-NGKVWSVASTVRFRVDRKD------DGGIIICEAQNQALPSGHSKQ 213

  Fly   440 -QLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSAWLTTMDAEAA 503
             |.:.:|:.:.:..        :.::.|....|....:|.|.||:........:....::...|.
Human   214 TQYVLDVQYSPTAR--------IHASQAVVREGDTLVLTCAVTGNPRPNQIRWNRGNESLPERAE 270

  Fly   504 TTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTIVLHVLNGEYSASAIK 568
            ....|.|                   :|.:|..|:|.|||..||.......|:|| ..|...|:.
Human   271 AVGETLT-------------------LPGLVSADNGTYTCEASNKHGHARALYVL-VVYDPGAVV 315

  Fly   569 SG--SVSWSALIGCHGYLHWRNVSTLLTLLW 597
            ..  ||.::.:.|....|.:..:..|:.::|
Human   316 EAQTSVPYAIVGGILALLVFLIICVLVGMVW 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 29/99 (29%)
V-set 204..290 CDD:284989 29/97 (30%)
CADM4NP_660339.1 Ig 29..120 CDD:416386 29/99 (29%)
FR1 29..45 CDD:409353 2/11 (18%)
Ig strand A' 30..36 CDD:409353 0/1 (0%)
Ig strand B 38..46 CDD:409353 3/8 (38%)
CDR1 46..51 CDD:409353 1/15 (7%)
FR2 52..59 CDD:409353 1/6 (17%)
Ig strand C 52..58 CDD:409353 1/5 (20%)
CDR2 60..71 CDD:409353 3/10 (30%)
Ig strand C' 62..66 CDD:409353 2/3 (67%)
Ig strand C' 68..71 CDD:409353 0/2 (0%)
FR3 72..107 CDD:409353 15/36 (42%)
Ig strand D 76..83 CDD:409353 3/6 (50%)
Ig strand E 86..92 CDD:409353 1/5 (20%)
Ig strand F 99..107 CDD:409353 5/7 (71%)
CDR3 108..111 CDD:409353 2/2 (100%)
Ig strand G 111..120 CDD:409353 2/8 (25%)
FR4 113..120 CDD:409353 2/6 (33%)
IgI_2_Necl-4 121..220 CDD:409468 21/164 (13%)
Ig strand B 141..145 CDD:409468 2/3 (67%)
Ig strand C 155..159 CDD:409468 0/3 (0%)
Ig strand E 182..186 CDD:409468 1/3 (33%)
Ig strand F 196..201 CDD:409468 0/4 (0%)
Ig strand G 213..216 CDD:409468 0/2 (0%)
Ig_3 224..295 CDD:404760 16/97 (16%)
Ig strand A' 231..235 CDD:409353 1/3 (33%)
Ig strand B 241..248 CDD:409353 2/6 (33%)
Ig strand C 255..260 CDD:409353 0/4 (0%)
Ig strand C' 262..264 CDD:409353 0/1 (0%)
Ig strand E 274..280 CDD:409353 2/24 (8%)
Ig strand F 287..294 CDD:409353 4/6 (67%)
Ig strand G 300..308 CDD:409353 3/8 (38%)
4.1m 344..362 CDD:128590 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5236
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.