DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and zig-3

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:184 Identity:40/184 - (21%)
Similarity:65/184 - (35%) Gaps:44/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RPVATTTLKPPPT---IDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIA 241
            |.:.:|.|...|:   |:..:......|....|.|:|.......|.|  .:||..:..|:...: 
 Worm    31 REIDSTHLTTKPSLKIIEGLEDNTVSTGESVTLRCDVLSTPTGVIYW--EKDGQRIQGDKELNV- 92

  Fly   242 DQRFQSVFS---PNPERW----SLQIKYVQLKDEGTYECQVSTEPKASAIVHLRI-VEPKTELIG 298
               |:.|.:   |..|..    |.||....|...|:|:| |:|....:.....:| ||.:|    
 Worm    93 ---FEKVLNAMGPTVESGIITSSYQIPCANLHHIGSYKC-VATNGHDTVESSAKISVEGQT---- 149

  Fly   299 ESTRHVKAGSQVKLRCIISQALEPPLFI-----------------NWFYNQKQI 335
                 ||..|..:...:|:.:.|....:                 ||.:..|:|
 Worm   150 -----VKCKSTRRSAPVITMSTESRFELQDNAATLICRADRRANWNWMFEDKKI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/98 (22%)
V-set 204..290 CDD:284989 23/93 (25%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 24/106 (23%)
Ig 61..142 CDD:143165 21/87 (24%)
IG_like 177..244 CDD:214653 4/22 (18%)
Ig <191..237 CDD:299845 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.