DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and zig-10

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001122644.1 Gene:zig-10 / 188896 WormBaseID:WBGene00020800 Length:322 Species:Caenorhabditis elegans


Alignment Length:170 Identity:42/170 - (24%)
Similarity:67/170 - (39%) Gaps:35/170 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 VATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHIL-TVD--QTTFIADQ 243
            :.|...|..||    :.::....|.| |.|  :......::|  .||.|:: ||:  :...:.::
 Worm    22 IHTLAPKKAPT----ERLVPIGSTTA-LEC--EPYTSSNVTW--YRDKHVIATVEGHKNAILNER 77

  Fly   244 RFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRI-------------VEPKTE 295
            :.:......||...|.|..||.:|||.|.||...:.|...:..|:|             :||...
 Worm    78 KPRGGEERIPEIGFLVIFDVQKEDEGNYYCQRENDSKWGEVFQLKIAYVDEISQNEKIKLEPNVP 142

  Fly   296 LIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQI 335
            .:|.|         :.|.|.|.:|..||. :.|..|...|
 Worm   143 TLGRS---------LVLHCPIPKAYPPPK-VTWTVNSLPI 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 24/94 (26%)
V-set 204..290 CDD:284989 25/101 (25%)
zig-10NP_001122644.1 IG_like 31..118 CDD:214653 25/95 (26%)
IGc2 38..111 CDD:197706 22/77 (29%)
IG_like 143..215 CDD:214653 11/40 (28%)
IGc2 145..209 CDD:197706 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.