DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Musk

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001032204.2 Gene:Musk / 18198 MGIID:103581 Length:893 Species:Mus musculus


Alignment Length:266 Identity:62/266 - (23%)
Similarity:90/266 - (33%) Gaps:66/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 KPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLR----MRDGHILTVDQTTFIADQRFQSV 248
            :||..:    .||.  |..|.|||......|..:||::    :|:...:.|              
Mouse   125 RPPINV----KIIE--GLKAVLPCTTMGNPKPSVSWIKGDNALRENSRIAV-------------- 169

  Fly   249 FSPNPERWSLQIKYVQLKDEGTYEC------------------QVSTEPKASAIVHLRIVEPKTE 295
                .|..||:|..||.:|.|.|.|                  :...||:..|.|..||      
Mouse   170 ----LESGSLRIHNVQKEDAGQYRCVAKNSLGTAYSKLVKLEVEEDREPEQDAKVFARI------ 224

  Fly   296 LIGESTRHVKAGSQVKLRCIISQALEPPL-FINWFYNQKQI---YLHNRRGWRTEIERIDLPAEV 356
            |....:.:|..||.|.|||   .|:..|: .|:|..|...:   .:......|....|:.|....
Mouse   225 LRAPESHNVTFGSFVTLRC---TAIGIPVPTISWIENGNAVSSGSIQESVKDRVIDSRLQLFITK 286

  Fly   357 PTTSTTTTT-------TTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILD 414
            |...|...|       :|..|:.|.:.....|.....|:...||.:.|.:...|.....|..:.|
Mouse   287 PGLYTCIATNKHGEKFSTAKAAATVSIAVPPPWFSMDTSFLWTEWSKSQKDSQGYCAQYRGEVCD 351

  Fly   415 AISQND 420
            |:...|
Mouse   352 AVLAKD 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/113 (23%)
V-set 204..290 CDD:284989 25/107 (23%)
MuskNP_001032204.2 I-set 28..117 CDD:254352
Ig 36..117 CDD:299845
I-set 121..208 CDD:254352 24/106 (23%)
Ig 135..201 CDD:299845 20/83 (24%)
I-set 223..306 CDD:254352 22/91 (24%)
Ig 239..306 CDD:143165 16/69 (23%)
CRD_TK_ROR_related 338..482 CDD:143578 5/20 (25%)
PTKc_Musk 593..882 CDD:133181
Pkinase_Tyr 599..880 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.