DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and zig-4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_509335.1 Gene:zig-4 / 181051 WormBaseID:WBGene00006981 Length:253 Species:Caenorhabditis elegans


Alignment Length:293 Identity:52/293 - (17%)
Similarity:90/293 - (30%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 VSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVK-----------------LRCIISQALEP 322
            ::..|...|.:|..:|....|:   .|.::.:.:::|                 |||.|...  |
 Worm    14 INAHPPMHAEMHSAVVTLANEI---DTNYLTSPAKIKIVAPLESALIPGGETYQLRCDIMST--P 73

  Fly   323 PLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTT 387
            ...|:|.:|.|.|...|         .:::..::.........|...||..|.      ..||  
 Worm    74 AATIHWKFNGKLIQGSN---------ELNVEEKLLNFGKAIVDTGIVASILTI------QCPS-- 121

  Fly   388 ATGSTEGATSSETLNGLVTITRSYILDAISQNDVSELGAAAGVAVATETSTAQLLTEVEATSSTS 452
              ....|..|....||..||                           || .|::..|.||:...|
 Worm   122 --AENSGTYSCVGYNGHQTI---------------------------ET-VAEVEIEGEASGCRS 156

  Fly   453 GTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAATTSA---WLTTMDAEAATTAATTTTTML 514
            ...:...::..|.:.:          ..||:.|......:.   |:...:.|           ::
 Worm   157 NHKSAPEIVFWTDSRF----------EMTGNVATLVCRANQQVDWVWMSNDE-----------LV 200

  Fly   515 PSSSFIKQITTASLIIPAVVKLDSGNYTCSPSN 547
            .::.....::...|:|..:|..|.|.|||...|
 Worm   201 KNNDKFTVLSNGDLVIKNIVWDDMGTYTCIARN 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 3/13 (23%)
V-set 204..290 CDD:284989 3/14 (21%)
zig-4NP_509335.1 I-set 47..147 CDD:254352 27/148 (18%)
Ig 65..144 CDD:143165 25/127 (20%)
IG_like 176..245 CDD:214653 13/69 (19%)
Ig <193..238 CDD:299845 10/52 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.