DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and zig-8

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:162 Identity:44/162 - (27%)
Similarity:81/162 - (50%) Gaps:10/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QTIIS-QAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQI 260
            |||:: .|...|||.|:|....:..|:|.|:.||.:||....||..|.|:| |...:...|.|.:
 Worm    42 QTIVNVVAENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQ-VSKKSANIWVLNL 105

  Fly   261 KYVQLKDEGTYECQVSTEPKASAIVHLRIVEP----KTELIGESTRHV--KAGSQVKLRCIISQA 319
            :..:.:|.|.|.|:::.:......|:|:::||    .:.|..:||:.:  .:|.:|.|.|.::..
 Worm   106 RRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTST 170

  Fly   320 --LEPPLFINWFYNQKQIYLHNRRGWRTEIER 349
              .|..|.:.|..:...|..::...:..:::|
 Worm   171 DKDEEVLDVVWTRDGNTINFNDTEKYILKVKR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 30/92 (33%)
V-set 204..290 CDD:284989 26/85 (31%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 24/79 (30%)
Ig 55..129 CDD:143165 22/74 (30%)
ig 158..229 CDD:278476 9/45 (20%)
IG_like 158..227 CDD:214653 9/45 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.