DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and CNTN4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_001193884.1 Gene:CNTN4 / 152330 HGNCID:2174 Length:1026 Species:Homo sapiens


Alignment Length:518 Identity:101/518 - (19%)
Similarity:166/518 - (32%) Gaps:136/518 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FRPTMAAALDAAAPNRSSNNVAINNIS----NNGDQRLR-LTAALEANL---------------- 112
            |:...|...:..|.|....|||...::    .|..|::. :..|:|.|:                
Human   285 FQQEDAGLYECVAENSRGKNVARGQLTFYAQPNWIQKINDIHVAMEENVFWECKANGRPKPTYKW 349

  Fly   113 ------IMSNRNVQ-EQHSYRITQDNATSAA---SIAPN--GTAFGDAPSIPIGVAPATTTTIDP 165
                  :::...:| ||.:..||..|.:.|.   .:|.|  |..|.:|....|.|.|..:.|:  
Human   350 LKNGEPLLTRDRIQIEQGTLNITIVNLSDAGMYQCLAENKHGVIFSNAELSVIAVGPDFSRTL-- 412

  Fly   166 ATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGH 230
                    .:|.|                     :.:.|....:.|..|...|...:|.:.||  
Human   413 --------LKRVT---------------------LVKVGGEVVIECKPKASPKPVYTWKKGRD-- 446

  Fly   231 ILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE--PKASAIVHLRIVEPK 293
            ||..::...|:            |..:|:|..|...|.|:|.| ::|.  ..||:..:|.:.:|.
Human   447 ILKENERITIS------------EDGNLRIINVTKSDAGSYTC-IATNHFGTASSTGNLVVKDPT 498

  Fly   294 TELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPT 358
            ..::..|:..|..|..:.|.|.::......:...|.:|...|.. :|.|  ...||:        
Human   499 RVMVPPSSMDVTVGESIVLPCQVTHDHSLDIVFTWSFNGHLIDF-DRDG--DHFERV-------- 552

  Fly   359 TSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSE 423
                                           |..:.|......|..:.....|:  .:.|..|..
Human   553 -------------------------------GGQDSAGDLMIRNIQLKHAGKYV--CMVQTSVDR 584

  Fly   424 LGAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAG---------LLASTSAAYAAGAAAGITTA 479
            |.|||.:.|.......:.:|..|.|.:|:..|...|         .:......::.|..|..|..
Human   585 LSAAADLIVRGPPGPPEAVTIDEITDTTAQLSWRPGPDNHSPITMYVIQARTPFSVGWQAVSTVP 649

  Fly   480 ATGDSAATAATTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTASL--IIPAVVKLDSGN 540
            ...|.....||.......::.|..|.||.......||....|:.|..:|  :.||.|....|:
Human   650 ELIDGKTFTATVVGLNPWVEYEFRTVAANVIGIGEPSRPSEKRRTEEALPEVTPANVSGGGGS 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/93 (24%)
V-set 204..290 CDD:284989 22/87 (25%)
CNTN4NP_001193884.1 Ig 25..118 CDD:325142
Ig 120..213 CDD:325142
Ig 225..313 CDD:325142 7/27 (26%)
Ig 318..401 CDD:325142 16/82 (20%)
Ig5_Contactin 422..494 CDD:319278 22/86 (26%)
Ig6_Contactin-4 513..597 CDD:143261 20/127 (16%)
FN3 597..690 CDD:238020 18/92 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 685..710 8/24 (33%)
FN3 703..795 CDD:238020 4/10 (40%)
FN3 804..896 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 886..907
FN3 904..989 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.