DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and Flt4

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:NP_032055.1 Gene:Flt4 / 14257 MGIID:95561 Length:1363 Species:Mus musculus


Alignment Length:196 Identity:40/196 - (20%)
Similarity:66/196 - (33%) Gaps:47/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TIDDYQTIISQ------AGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQR----FQ 246
            ||.|..:|.|:      .|....|.|.......:.:.|.|:....:........:.|.:    |.
Mouse   553 TIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHDAQGNPLLLDCKNVHLFA 617

  Fly   247 SVFSPNPER---------WSLQIKYVQLKDEGTYECQVSTEPKASAIVHL-----------RIVE 291
            :....|.|.         .||.|..|..:|||.|.|:|..........|.           |:.:
Mouse   618 TPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRSQDKHCHKKYLSVQALEAPRLTQ 682

  Fly   292 PKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRG-------WRTEIER 349
            ..|:|:      |.....:::||.::.|..|.  |.|:.:::  .|....|       .|..|:|
Mouse   683 NLTDLL------VNVSDSLEMRCPVAGAHVPS--IVWYKDER--LLEKESGIDLADSNQRLSIQR 737

  Fly   350 I 350
            :
Mouse   738 V 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 22/121 (18%)
V-set 204..290 CDD:284989 21/109 (19%)
Flt4NP_032055.1 IG_like 238..327 CDD:214653
Ig1_VEGFR 245..329 CDD:143270
IG_like 341..415 CDD:214653
Ig 352..418 CDD:299845
Ig 569..662 CDD:299845 19/92 (21%)
IG 570..663 CDD:214652 19/92 (21%)
I-set 678..765 CDD:254352 15/71 (21%)
IGc2 693..755 CDD:197706 11/50 (22%)
PKc_like 837..1175 CDD:304357
Pkinase_Tyr 845..1169 CDD:285015
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1288..1330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.