DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP011700

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_320810.2 Gene:AgaP_AGAP011700 / 1280937 VectorBaseID:AGAP011700 Length:205 Species:Anopheles gambiae


Alignment Length:203 Identity:41/203 - (20%)
Similarity:75/203 - (36%) Gaps:56/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 TTTLKPPPTIDDYQTIISQA-GTHAYLPC----NVKQLVKKPISWLRMRDGHILTVDQTTFIADQ 243
            |..:|..|.|..:.:.|:.| |.:..:.|    |.:   .:.|.|:| .|..:.:|...|.|.:.
Mosquito    15 TVVVKGSPIIHKHSSYINTAIGENVEMVCLYDSNPE---PRKIQWIR-NDEIVQSVPAQTIITND 75

  Fly   244 RFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTE-------------PKASAIVH--------- 286
            ...     :..|..|.||.||.||...|.|::..|             |..:.::|         
Mosquito    76 HHN-----HHNRTRLTIKNVQQKDLQAYYCKIENELGEAVSKTILGLTPGGAHLIHSNSSDGLLH 135

  Fly   287 ----LRIVEPKTELI----GESTRHVKAGSQVK--------LRCIISQALEPPLFINWFYNQKQI 335
                :..::..||::    ||:|:::...:::.        ....|.:::..|.. .||...:  
Mosquito   136 TWWKIHSIQQITEMLVLYRGENTKYIPVTAEISSHDQNPDGYTWTIRKSIRLPEG-EWFVTAR-- 197

  Fly   336 YLHNRRGW 343
             ..|..||
Mosquito   198 -ARNTEGW 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/122 (20%)
V-set 204..290 CDD:284989 23/115 (20%)
AgaP_AGAP011700XP_320810.2 IG_like 36..115 CDD:214653 21/87 (24%)
Ig 39..113 CDD:143165 20/82 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.