DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP010221

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_554132.3 Gene:AgaP_AGAP010221 / 1279644 VectorBaseID:AGAP010221 Length:370 Species:Anopheles gambiae


Alignment Length:114 Identity:34/114 - (29%)
Similarity:56/114 - (49%) Gaps:15/114 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYEC 273
            |.|.|..|....::|||:....|||:.......::|....:: ..:.|.|:||.::..|.|.|.|
Mosquito     1 LTCVVHDLGAYKVAWLRVDTQTILTIQNHVITKNKRIGITYT-EKKTWQLRIKDIRETDRGWYMC 64

  Fly   274 QVSTEPKASAIVHLRIVEP--------KTELIGESTRHVKAGSQVKLRC 314
            |::|:|..|.:.:|.:|.|        .|:::      |:.||.|.|||
Mosquito    65 QINTDPMKSQMGYLDVVVPPDILDYPTSTDMV------VREGSNVTLRC 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 24/79 (30%)
V-set 204..290 CDD:284989 24/80 (30%)
AgaP_AGAP010221XP_554132.3 IG_like 1..76 CDD:214653 23/75 (31%)
Ig 1..74 CDD:143165 22/73 (30%)
IG_like 92..176 CDD:214653 8/22 (36%)
IGc2 99..164 CDD:197706 6/9 (67%)
IG_like 191..273 CDD:214653
Ig 197..270 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.