DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP009688

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_318747.4 Gene:AgaP_AGAP009688 / 1279077 VectorBaseID:AGAP009688 Length:785 Species:Anopheles gambiae


Alignment Length:390 Identity:83/390 - (21%)
Similarity:126/390 - (32%) Gaps:127/390 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 ILNSNGTNGRAFQRTQSRREALIPATTQ---------------------MAQTLDKASAFR---- 70
            |.|.|||.|..        |.:||...|                     :..|:.....||    
Mosquito   447 INNENGTIGTT--------ELIIPNIQQAGAGKYQCIITNNYGVVYSPKVKVTVGTYPKFRKTPS 503

  Fly    71 -----PTMAAALDAAAPNRSSNNVAINNISNNG-----DQRLRLTAALEANLIMSNRNVQ--EQH 123
                 |...|.|:.||.......:.......|.     ::|:.:....:|.||:   |||  :..
Mosquito   504 DVSVEPGKVARLNCAAMGDPKPQIYWEKDGGNDFPAAKERRMHVIPNEDAFLIL---NVQLVDMG 565

  Fly   124 SYRITQDNATSAASIAPNGTAFGDAPSIPIGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLK 188
            .|..|.:|                    |.||..|..:.|        .....|..|||.     
Mosquito   566 VYSCTAEN--------------------PAGVIRANASVI--------VLESETAARPVT----- 597

  Fly   189 PPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNP 253
                  :.:|.|.:|   :.:.|.|....|..|.||  :||..:.:.:..||..           
Mosquito   598 ------NLETAIGKA---SVIECKVSASPKPVIFWL--KDGEPIGLTERHFITG----------- 640

  Fly   254 ERWSLQIKYVQLKDEGTYECQVSTE-PKASAIVHLRIVEPKTEL----IGES-TRHVKAGSQVKL 312
            |...|.|...:..|.|.|||:...| ........|.:|:...::    :||: |.....|....:
Mosquito   641 EGQLLVIVDTEQTDAGLYECRFENEIISEGGSTRLTVVDGPEDMHGSVLGETGTYGAGGGGLALI 705

  Fly   313 RCIISQALEPPLFINWFYN-QKQIYLHNRRGW-----RTEIE-----RIDLPAEVPTTSTTTTTT 366
            .||:   |...:::...|. ||:|    |||.     .||::     .|:.|..:..:...|:||
Mosquito   706 GCIV---LTSCIWMCCLYRMQKRI----RRGGSGCPKETELDLATGMEINQPNLIVRSGVGTSTT 763

  Fly   367  366
            Mosquito   764  763

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 23/92 (25%)
V-set 204..290 CDD:284989 20/86 (23%)
AgaP_AGAP009688XP_318747.4 LRR_RI <1..219 CDD:238064
LRR_8 16..76 CDD:290566
leucine-rich repeat 18..41 CDD:275380
leucine-rich repeat 42..65 CDD:275380
LRR_8 65..147 CDD:290566
leucine-rich repeat 66..89 CDD:275380
leucine-rich repeat 90..136 CDD:275380
LRR_8 136..195 CDD:290566
leucine-rich repeat 137..160 CDD:275380
LRR_RI 139..345 CDD:238064
leucine-rich repeat 161..184 CDD:275380
LRR_8 183..243 CDD:290566
leucine-rich repeat 185..208 CDD:275380
leucine-rich repeat 209..232 CDD:275380
leucine-rich repeat 233..256 CDD:275380
LRR_8 255..318 CDD:290566
leucine-rich repeat 257..283 CDD:275380
leucine-rich repeat 284..307 CDD:275380
leucine-rich repeat 308..328 CDD:275380
LRRCT 342..389 CDD:214507
I-set 395..492 CDD:254352 10/52 (19%)
Ig 412..483 CDD:143165 10/43 (23%)
I-set 496..586 CDD:254352 23/120 (19%)
Ig 513..587 CDD:299845 20/104 (19%)
I-set 594..677 CDD:254352 26/109 (24%)
Ig 596..677 CDD:299845 24/107 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.