DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP007759

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_317756.4 Gene:AgaP_AGAP007759 / 1278206 VectorBaseID:AGAP007759 Length:238 Species:Anopheles gambiae


Alignment Length:232 Identity:74/232 - (31%)
Similarity:110/232 - (47%) Gaps:32/232 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   197 QTIISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIK 261
            :.|.::.|..|::.|.|:|:..|.:||:|.||.|||:.....:.:|:|||.:.|...|.|:||||
Mosquito    10 RNITTRVGQTAFINCRVEQMGDKSVSWIRKRDLHILSAGTAVYTSDERFQVIRSDKAENWTLQIK 74

  Fly   262 YVQLKDEGTYECQVSTEPKASAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFI 326
            :.|.:|.|.|||||:||||.|....|.:||.|..::|.:..:||.||.|.|.|||||.......|
Mosquito    75 FAQQRDSGIYECQVNTEPKMSMAFRLNVVEAKAIILGPTDLYVKMGSVVTLTCIISQGPHDLGTI 139

  Fly   327 NWFYNQKQIYLHNRRG---------WRT---EIERIDLPAEVPTTSTTTTTTTTTASTTTTTTST 379
            .|:           ||         ||:   .:.:| |.|::..:...|...|:...|:......
Mosquito   140 YWY-----------RGKYADAGHVLWRSNYCSMLKI-LDAKLSDSGNYTCLPTSAEGTSVMVHVI 192

  Fly   380 TPATPSTTATGSTEGATSSE--------TLNGLVTIT 408
            ....|:....|....|...:        |:..||.:|
Mosquito   193 NGEHPAAMQRGCATTADKDQHRSMQLLMTMLALVLLT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 40/91 (44%)
V-set 204..290 CDD:284989 39/85 (46%)
AgaP_AGAP007759XP_317756.4 IG_like 9..102 CDD:214653 40/91 (44%)
Ig 12..88 CDD:299845 32/75 (43%)
IG_like 112..191 CDD:214653 23/90 (26%)
Ig_3 117..177 CDD:290638 20/71 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.