DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP006274

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_316339.4 Gene:AgaP_AGAP006274 / 1276929 VectorBaseID:AGAP006274 Length:161 Species:Anopheles gambiae


Alignment Length:148 Identity:35/148 - (23%)
Similarity:67/148 - (45%) Gaps:16/148 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 SAIVHLRIVEPKTELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQI-YLHNRR---- 341
            |..|:|::|.|:..::|....||..||.:.|.|||.::.:||.::.|..|.:.| |..:||    
Mosquito     9 SHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPQPPQYVYWQRNDRMINYDDSRRDITI 73

  Fly   342 ----GWRTEIERIDLPAEVPTTSTTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLN 402
                |.||:...|....::..:...|.:.:.|...:.....:.....:..:...|.||.::..|:
Mosquito    74 ETTPGPRTQSRLIIREPQINDSGNYTCSASNTEPASIYVFVSKGDNTAAISRRKTSGAAATSQLS 138

  Fly   403 GLV-------TITRSYIL 413
            .::       ::..||:|
Mosquito   139 AILFECLFFPSVILSYLL 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 3/6 (50%)
V-set 204..290 CDD:284989 3/7 (43%)
AgaP_AGAP006274XP_316339.4 IG_like 26..105 CDD:214653 21/78 (27%)
Ig 37..104 CDD:143165 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.