DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP008778

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_314904.3 Gene:AgaP_AGAP008778 / 1275637 VectorBaseID:AGAP008778 Length:241 Species:Anopheles gambiae


Alignment Length:127 Identity:36/127 - (28%)
Similarity:59/127 - (46%) Gaps:5/127 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 GTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDE 268
            |..|.|.|.|..|....::|:|:....||::.......:.|....::.: ..|.|.|:.|:..|.
Mosquito    15 GRDALLACVVDNLKGYKVAWVRVDTQTILSIHHNVITQNPRISLTYNDH-RSWYLHIREVEESDR 78

  Fly   269 GTYECQVSTEPKASAIVHLRIVEPKT--ELIGESTRHVKAGSQVKLRCIISQALEPPLFINW 328
            |.|.|||:|:|..|...:|::|.|..  |.:..:...|:.|:.|.|.|......||  ::.|
Mosquito    79 GWYMCQVNTDPMRSRKGYLQVVVPPAIIESMTSNDMVVREGTNVTLNCKAKGFPEP--YVMW 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/84 (30%)
V-set 204..290 CDD:284989 25/85 (29%)
AgaP_AGAP008778XP_314904.3 IG_like 8..101 CDD:214653 25/86 (29%)
Ig 9..99 CDD:299845 25/84 (30%)
IG_like 111..194 CDD:214653 8/30 (27%)
IGc2 118..182 CDD:197706 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.