DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP008655

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_314755.4 Gene:AgaP_AGAP008655 / 1275506 VectorBaseID:AGAP008655 Length:408 Species:Anopheles gambiae


Alignment Length:389 Identity:73/389 - (18%)
Similarity:119/389 - (30%) Gaps:101/389 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 PATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQAGTHAYLPCNVKQLVKKPISWLRMRDG 229
            |....|......|..|.|:.|.:  ...:..|:|:.:  .||.|          ..::|::....
Mosquito    16 PEFLAPLDNLTVTQGRDVSFTCV--VNNLGQYRTLTT--STHVY----------PQVAWIKSDSK 66

  Fly   230 HILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDEGTYECQVSTEPKASAIVHLRIVEPKT 294
            .||.: .|..:|.....||.......|.|.|.:|||.|.|:|.|||:|:|....:..|...|.||
Mosquito    67 AILAI-HTHMVALNPRLSVTHNGHNTWKLHISHVQLNDSGSYMCQVNTDPMRHQVSALNESEGKT 130

  Fly   295 ELIGESTRHVKAGSQVKLRCIISQALEPPLFINWFYNQKQIYLHNRRGWRTEIERIDLPAEVPTT 359
                .:...:.||...|::|:                  ::..|.:.....:..|        ..
Mosquito   131 ----STASSLSAGLVCKIQCL------------------KMCTHKKNNPHHQSPR--------PN 165

  Fly   360 STTTTTTTTTASTTTTTTSTTPATPSTTATGSTEGATSSETLNGLVTITRSYILDAISQNDVSEL 424
            |......:...|......:...|.||....|..:...:...:..:     .|.|..|::.:..|.
Mosquito   166 SGQRFNVSRNESVLGCCFAFLSAFPSHQPNGPAQHEATRTPVYAV-----PYALSCINEPNTLEG 225

  Fly   425 GAAAGVAVATETSTAQLLTEVEATSSTSGTSTGAGLLASTSAAYAAGAAAGITTAATGDSAATAA 489
            |      ||.|....||:.:                            |.|:...|.        
Mosquito   226 G------VANEGGNVQLVCQ----------------------------ATGVPEPAV-------- 248

  Fly   490 TTSAWLTTMDAEAATTAATTTTTMLPSSSFIKQITTASLIIPAVVKLDSGNYTCSPSNSAPRTI 553
               .|......:      ....|.......:|.:....|::..|.:.|.|.|.|..||..|.::
Mosquito   249 ---QWRRENGKD------IVVRTEGREKQVVKFVEGERLVLNQVQRTDMGGYLCIASNGVPPSV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/91 (29%)
V-set 204..290 CDD:284989 25/85 (29%)
AgaP_AGAP008655XP_314755.4 I-set 16..134 CDD:254352 36/136 (26%)
Ig 25..111 CDD:299845 26/100 (26%)
IG_like 227..311 CDD:214653 20/122 (16%)
IGc2 230..299 CDD:197706 17/113 (15%)
Ig 314..408 CDD:299845
IG_like 332..408 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.