DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP010542

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_314509.4 Gene:AgaP_AGAP010542 / 1275271 VectorBaseID:AGAP010542 Length:168 Species:Anopheles gambiae


Alignment Length:155 Identity:55/155 - (35%)
Similarity:77/155 - (49%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 TAFGDAPSIP-------IGVAPATTTTIDPATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTII 200
            |:.|..|..|       :..:.|...|...:.:||..|::.....|....|..        :.:.
Mosquito    22 TSGGIQPHQPYDGYKSFLDTSTAHLRTYVASGSTPGQTSQSKWEEPYFDDTTP--------RNVT 78

  Fly   201 SQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQL 265
            ...|..|||.|.||.|..|.:||:|.||.|||||...|:.:|||||:....:.:.|:||||:.|.
Mosquito    79 GLVGKSAYLSCRVKNLGNKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHKDVDDWTLQIKWAQK 143

  Fly   266 KDEGTYECQVSTEPKASAIVHLRIV 290
            :|.|.||||:||:|..|..|.|.:|
Mosquito   144 RDAGIYECQISTQPVRSYFVTLSVV 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 43/91 (47%)
V-set 204..290 CDD:284989 43/85 (51%)
AgaP_AGAP010542XP_314509.4 V-set 72..168 CDD:284989 44/103 (43%)
IG_like 74..167 CDD:214653 43/100 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.