DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP002802

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_312112.3 Gene:AgaP_AGAP002802 / 1273160 VectorBaseID:AGAP002802 Length:855 Species:Anopheles gambiae


Alignment Length:171 Identity:42/171 - (24%)
Similarity:64/171 - (37%) Gaps:52/171 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 LPCNVKQLVKKPISWLRMRDGH--ILT----VDQTTFIADQRFQS----VFSPNPERWSLQIKYV 263
            ||.:..|  :||:       ||  :||    |..|..|:|.|:..    ...|.|...|..:.|.
Mosquito    13 LPASSVQ--RKPV-------GHSLLLTCRPEVPDTNLISDLRWNDNRNMTILPKPAGQSSPLIYT 68

  Fly   264 Q--------------LKDE--GTYECQVS---TEPKASAIVHLRIVEPKTELI---GESTRHVKA 306
            :              |::.  |||.|..|   ||...:|:|    ||....:.   ..:.:....
Mosquito    69 ESIAGGTALALIFNSLQESMAGTYFCAASYSVTEKLNAAVV----VETYVAITWKDAPTDQRPLM 129

  Fly   307 GSQVKLRCIISQALEPPLFINWFYNQKQI-----YLHNRRG 342
            |:...:||.::  ..||..::|..|..||     |:...||
Mosquito   130 GTDYIVRCEVT--ANPPATVDWLRNGDQIKSSGRYVIENRG 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 28/108 (26%)
V-set 204..290 CDD:284989 28/109 (26%)
AgaP_AGAP002802XP_312112.3 Ig 11..104 CDD:299845 26/99 (26%)
IG_like 16..103 CDD:214653 23/95 (24%)
IGc2 129..186 CDD:197706 12/42 (29%)
Ig 207..299 CDD:299845
I-set 207..296 CDD:254352
Ig 298..389 CDD:299845
IG_like 307..401 CDD:214653
ig 411..491 CDD:278476
IG_like 414..497 CDD:214653
FN3 509..596 CDD:238020
FN3 619..707 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.