DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP009518

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_310174.4 Gene:AgaP_AGAP009518 / 1271391 VectorBaseID:AGAP009518 Length:464 Species:Anopheles gambiae


Alignment Length:281 Identity:66/281 - (23%)
Similarity:99/281 - (35%) Gaps:61/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SNNGDQRLRLTAALE-------ANLIMSNRNVQEQH----SYRITQDNATSAASIAPNGTAF--- 145
            |.||:|::..:.||:       |:.:..:|.|...|    ..|:...|..:|......|...   
Mosquito    14 SINGNQQISKSDALKLTPEEEMAHFVNQSRMVTCSHPDHPEVRLKWRNPKNAIISETKGRVHIED 78

  Fly   146 -GDAPSIPIGVAPAT-----TTTIDPATTTPTTTTRRTTRRPVATTTLK----PPPTIDDYQTI- 199
             ||:.::.......|     |..:|...|...|..|.|.  |....:.|    .|.:..|..|: 
Mosquito    79 KGDSLALIFEAIARTDQGNWTCEVDVEGTATATEGRVTV--PALRKSFKMIVYEPISFRDTNTVQ 141

  Fly   200 ISQAGTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWS-----LQ 259
            .:.....|.:.|.||...:..:||.              |.....|..:|| |..|:|     :.
Mosquito   142 TAVEDKDATIRCEVKGHPEPSVSWY--------------FNGQPLFCKLFS-NNGRYSKLADGMS 191

  Fly   260 IKYVQLKDEGTYECQV--------STEPKASA--IVHLRIVEPKTELIGESTRHVKAGSQVKLRC 314
            ||.|...|.|.|.|:.        |.|.|...  |.|...:.|..:.|.::..:|  |..|.|.|
Mosquito   192 IKKVVQNDSGEYTCKAFQISATGSSFEEKTIRLNIKHKPYMPPWKKSISDAYGYV--GGMVNLTC 254

  Fly   315 IISQALEPPLFINWFYNQKQI 335
              ....|||...:|..|.|::
Mosquito   255 --EATAEPPANFSWSANNKKL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 26/107 (24%)
V-set 204..290 CDD:284989 25/100 (25%)
AgaP_AGAP009518XP_310174.4 IG_like 45..117 CDD:214653 14/71 (20%)
Ig <67..102 CDD:299845 5/34 (15%)
IGc2 145..207 CDD:197706 20/76 (26%)
IG_like 240..320 CDD:214653 11/38 (29%)
Ig 250..318 CDD:143165 9/26 (35%)
FN3 325..429 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.