DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr15 and AgaP_AGAP011194

DIOPT Version :9

Sequence 1:NP_001287299.1 Gene:dpr15 / 41473 FlyBaseID:FBgn0037993 Length:662 Species:Drosophila melanogaster
Sequence 2:XP_309450.4 Gene:AgaP_AGAP011194 / 1270731 VectorBaseID:AGAP011194 Length:470 Species:Anopheles gambiae


Alignment Length:192 Identity:48/192 - (25%)
Similarity:77/192 - (40%) Gaps:38/192 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 NGTAFGDAPSIPIGVAPATTTTIDP--ATTTPTTTTRRTTRRPVATTTLKPPPTIDDYQTIISQA 203
            :||:||::.|.|:         :||  ..:.|....:.|:|.                |::.:..
Mosquito     6 SGTSFGNSLSDPL---------LDPDFIDSPPMVQPKFTSRS----------------QSVRAVI 45

  Fly   204 GTHAYLPCNVKQLVKKPISWLRMRDGHILTVDQTTFIADQRFQSVFSPNPERWSLQIKYVQLKDE 268
            |....|||.|:.|.:..:.|  .|...::|........|.||:.:     |.:|||||.|:.:|.
Mosquito    46 GDTITLPCEVENLGRNILLW--RRGSAVVTAANLIITRDTRFKLL-----EGYSLQIKNVRPQDA 103

  Fly   269 GTYECQVSTEPKASAIVHLRIVEPKTELIGESTRH--VKAGSQVKLRCIISQALEPPLFINW 328
            |.|.||:........:..:.|:.|.:......|.|  |:.|....|.|..|.  .|...|:|
Mosquito   104 GDYNCQIGDHDNRDLVHTVEILVPPSVRSNPETGHVTVRKGGTATLECKASG--NPVPSISW 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr15NP_001287299.1 IG_like 197..289 CDD:214653 25/91 (27%)
V-set 204..290 CDD:284989 24/85 (28%)
AgaP_AGAP011194XP_309450.4 IG_like 38..126 CDD:214653 26/110 (24%)
Ig 49..110 CDD:143165 22/67 (33%)
IG_like 137..214 CDD:214653 9/29 (31%)
IGc2 144..200 CDD:197706 7/22 (32%)
I-set 218..305 CDD:254352
Ig 235..304 CDD:143165
FN3 <357..415 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.